General Information of the Molecule (ID: Mol00159)
Name
SHC-transforming protein 1 (SHC1) ,Homo sapiens
Synonyms
SHC-transforming protein 3; SHC-transforming protein A; Src homology 2 domain-containing-transforming protein C1; SH2 domain protein C1; SHC; SHCA
    Click to Show/Hide
Molecule Type
Protein
Gene Name
SHC1
Gene ID
6464
Location
chr1:154962298-154974395[-]
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
    Click to Show/Hide
3D-structure
PDB ID
2L1C
Classification
Cell adhesion
Method
Solution nmr
Resolution
No Resolution Dat Å
Function
Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p46Shc and isoform p52Shc, once phosphorylated, couple activated receptor tyrosine kinases to Ras via the recruitment of the GRB2/SOS complex and are implicated in the cytoplasmic propagation of mitogenic signals. Isoform p46Shc and isoform p52Shc may thus function as initiators of the Ras signaling cascade in various non-neuronal systems. Isoform p66Shc does not mediate Ras activation, but is involved in signal transduction pathways that regulate the cellular response to oxidative stress and life span. Isoform p66Shc acts as a downstream target of the tumor suppressor p53 and is indispensable for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome c release and apoptosis. The expression of isoform p66Shc has been correlated with life span (By similarity). Participates in signaling downstream of the angiopoietin receptor TEK/TIE2, and plays a role in the regulation of endothelial cell migration and sprouting angiogenesis.
    Click to Show/Hide
Uniprot ID
SHC1_HUMAN
Ensembl ID
ENSG00000160691
HGNC ID
HGNC:10840
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Non-small cell lung cancer [ICD-11: 2C25.Y] [1]
Sensitive Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Sensitive Drug Cisplatin
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Lung cancer [ICD-11: 2C25]
The Specified Disease Lung cancer
The Studied Tissue Lung tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 2.14E-04
Fold-change: 2.13E-02
Z-score: 3.74E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
p53/p66shc signaling pathway Activation hsa04115
In Vitro Model A549 cells Lung Homo sapiens (Human) CVCL_0023
A549/DDP cells Lung Homo sapiens (Human) CVCL_0023
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
CCK8 assay; Flow cytometric analysis
Mechanism Description Downregulated long non-coding RNA TRPM2-AS inhibits cisplatin resistance of non-small cell lung cancer cells via activation of p53- p66shc pathway.
Alectinib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] [2]
Sensitive Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Sensitive Drug Alectinib
Molecule Alteration Phosphorylation
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vivo Model Crizotinib-resistant PDX mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot assay
Mechanism Description SHC1 phosphorylation was increased in CR mice
Crizotinib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] [2]
Resistant Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Resistant Drug Crizotinib
Molecule Alteration Phosphorylation
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vivo Model Crizotinib-resistant PDX mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot assay
Mechanism Description SHC1 phosphorylation was increased in CR mice
Gemcitabine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Pancreatic cancer [ICD-11: 2C10.3] [3]
Resistant Disease Pancreatic cancer [ICD-11: 2C10.3]
Resistant Drug Gemcitabine
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model PANC-1 cells Pancreas Homo sapiens (Human) CVCL_0480
AsPC-1 cells Pancreas Homo sapiens (Human) CVCL_0152
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description miR-365 directly targets the pro-apoptotic molecules SHC1 and BAX, whose reductions contribute to gemcitabine resistance in pancreatic cancer cells.
Idebenone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Nonalcoholic fatty liver disease [ICD-11: DB92.0] [4]
Resistant Disease Nonalcoholic fatty liver disease [ICD-11: DB92.0]
Resistant Drug Idebenone
Molecule Alteration Expression
Down-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vivo Model Fast food diet (FFD) mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Glucose tolerance test (GTT); Insulin tolerance test (ITT)
Mechanism Description In the metabolic FFD model, idebenone administration improved insulin resistance, and reduced inflammation and fibrosis shown with qPCR, hydroxyproline measurement, and histology.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
ASP3026
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] [2]
Sensitive Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Sensitive Drug ASP3026
Molecule Alteration Phosphorylation
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vivo Model Crizotinib-resistant PDX mouse model Mus musculus
Experiment for
Molecule Alteration
Western blot assay
Mechanism Description SHC1 phosphorylation was increased in CR mice
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.28E-03; Fold-change: 3.13E-01; Z-score: 5.54E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.28E-04; Fold-change: 6.00E-01; Z-score: 8.28E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Lung
The Specified Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.14E-04; Fold-change: 6.00E-02; Z-score: 1.55E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.13E-01; Fold-change: -1.53E-01; Z-score: -3.22E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the Resistance Disease of This Class
Nonalcoholic fatty liver disease [ICD-11: DB92]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Liver
The Specified Disease Nonalcoholic fatty liver disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.27E-01; Fold-change: 1.14E-01; Z-score: 5.38E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Downregulated long non-coding RNA TRPM2-AS inhibits cisplatin resistance of non-small cell lung cancer cells via activation of p53- p66shc pathway. Eur Rev Med Pharmacol Sci. 2017 Jun;21(11):2626-2634.
Ref 2 AXL and SHC1 confer crizotinib resistance in patient-derived xenograft model of ALK-driven lung cancer. iScience. 2024 Aug 30;27(9):110846.
Ref 3 MiR-365 induces gemcitabine resistance in pancreatic cancer cells by targeting the adaptor protein SHC1 and pro-apoptotic regulator BAX. Cell Signal. 2014 Feb;26(2):179-85. doi: 10.1016/j.cellsig.2013.11.003. Epub 2013 Nov 9.
Ref 4 Shc inhibitor idebenone ameliorates liver injury and fibrosis in dietary NASH in mice .J Biochem Mol Toxicol. 2021 Oct;35(10):e22876. doi: 10.1002/jbt.22876. Epub 2021 Aug 8. 10.1002/jbt.22876

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.