Molecule Information
General Information of the Molecule (ID: Mol00157)
| Name |
Selenoprotein W (SEPW1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
SelW; SELW; SEPW1
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SELENOW
|
||||
| Gene ID | |||||
| Location |
chr19:47778677-47784686[+]
|
||||
| Sequence |
MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSK
KKGDGYVDTESKFLKLVAAIKAALAQG Click to Show/Hide
|
||||
| Function |
Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast cancer [ICD-11: 2C60.3] | [1] | |||
| Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
| Sensitive Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Breast cancer [ICD-11: 2C60] | |||
| The Specified Disease | Breast cancer | |||
| The Studied Tissue | Breast tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.83E-06 Fold-change: -1.62E-02 Z-score: -4.46E+00 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell migration | Activation | hsa04670 | ||
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
| ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Luciferase reporter assay | |||
| Experiment for Drug Resistance |
Flow cytometry assay | |||
| Mechanism Description | PIWI-interacting RNA-36712 restrains breast cancer progression and chemoresistance by interaction with SEPW1 pseudogene SEPW1P RNA. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast cancer [ICD-11: 2C60.3] | [1] | |||
| Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
| Sensitive Drug | Paclitaxel | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell migration | Activation | hsa04670 | ||
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
| ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
| In Vivo Model | Mouse xenograft models | Mus musculus | ||
| Experiment for Molecule Alteration |
Luciferase reporter assay; Western blot analysis | |||
| Experiment for Drug Resistance |
Flow cytometry assay | |||
| Mechanism Description | PIWI-interacting RNA-36712 restrains breast cancer progression and chemoresistance by interaction with SEPW1 pseudogene SEPW1P RNA. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Breast tissue | |
| The Specified Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.83E-06; Fold-change: -9.40E-02; Z-score: -2.49E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.23E-01; Fold-change: -8.84E-02; Z-score: -1.68E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
