Molecule Information

General Information of the Molecule (ID: Mol00112)

• Name: Myocyte-specific enhancer factor 2D (MEF2D) ,Homo sapiens
• Molecule Type: Protein
• Gene Name: MEF2D
• Gene ID: 4209
• Location: chr1:156463727-156500779[-]
• Sequence:
  MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
  DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
  SEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLS
  PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
  NSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
  SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
  VTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
  LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYET
  GDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK
• Function: Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis (By similarity).
• Uniprot ID: MEF2D_HUMAN
• Ensembl ID: ENSG00000116604
• HGNC ID: HGNC:6997

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Cisplatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Non-small cell lung cancer [1]

• Sensitive Disease: Non-small cell lung cancer [ICD-11: 2C25.Y]
• Sensitive Drug: Cisplatin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Caspase-3 signaling pathway; Activation; hsa04210
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• In Vitro Model: NCI-H522 cells; Lung; Homo sapiens (Human); CVCL_1567
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: MTT assay; LDH assay; Flow cytometric analysis
• Mechanism Description: Overexpression of miR1244 suppressed cell viability and increased LDH toxicity in cisplatin-treated A549 and NCI-H522 cells and induced the apoptosis of cisplatin-treated A549 and NCI-H522 cells. Overexpression of miR1244 promoted caspase-3 activity and p53 and Bax protein expression, and suppressed MEF2D and cyclin D1 protein expression in cisplatin treated A549 and NCI-H522 cells.

Doxorubicin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gastric cancer [2]

• Sensitive Disease: Gastric cancer [ICD-11: 2B72.1]
• Sensitive Drug: Doxorubicin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: miR422a/MEF2D signaling pathway; Regulation; hsa05206
• In Vitro Model: MGC-803 cells; Gastric; Homo sapiens (Human); CVCL_5334
• In Vitro Model: SGC7901 cells; Gastric; Homo sapiens (Human); CVCL_0520
• In Vitro Model: BGC823 cells; Gastric; Homo sapiens (Human); CVCL_3360
• In Vitro Model: GES-1 cells; Gastric; Homo sapiens (Human); CVCL_EQ22
• In Vitro Model: NCI-N87 cells; Gastric; Homo sapiens (Human); CVCL_1603
• In Vivo Model: Nude mouse xenograft model; Mus musculus
• Experiment for Molecule Alteration: RT-qPCR
• Experiment for Drug Resistance: MTT assay; Flow cytometry assay
• Mechanism Description: MEF2D expression markedly inhibited BGC823 cell proliferation and migration and invasion and enhanced the sensitivity of gastric cancer cells to chemotherapy.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Gastric cancer [ICD-11: 2B72]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Gastric tissue
• The Specified Disease: Gastric cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 1.42E-01; Fold-change: -1.87E-01; Z-score: -9.54E-01
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 3.98E-01; Fold-change: 6.47E-02; Z-score: 2.22E-01

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.59E-01; Fold-change: 2.67E-03; Z-score: 8.77E-03
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 2.28E-04; Fold-change: -9.71E-02; Z-score: -3.15E-01

References

• Ref 1: Effect of miR-1244 on cisplatin-treated non-small cell lung cancer via MEF2D expression. Oncol Rep. 2017 Jun;37(6):3475-3483. doi: 10.3892/or.2017.5624. Epub 2017 May 4.
• Ref 2: The Long Noncoding RNA D63785 Regulates Chemotherapy Sensitivity in Human Gastric Cancer by Targeting miR-422a. Mol Ther Nucleic Acids. 2018 Sep 7;12:405-419. doi: 10.1016/j.omtn.2018.05.024. Epub 2018 Jul 5.