Molecule Information
General Information of the Molecule (ID: Mol00109)
Name |
Melanoma-associated antigen 12 (MAGEA12)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Cancer/testis antigen 1.12; CT1.12; MAGE-12 antigen; MAGE12F antigen; MAGE12
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
MAGEA12
|
||||
Gene ID | |||||
Location |
chrX:152733757-152737669[+]
|
||||
Sequence |
MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPS
PPHSPQGASTLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVT CLGLSYDGLLGDNQIVPKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHLLKISGGPHIS YPPLHEWAFREGEE Click to Show/Hide
|
||||
Function |
Not known, though may play a role tumor transformation or progression. In vitro promotes cell viability in melanoma cell lines.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Medulloblastoma | [1] | |||
Sensitive Disease | Medulloblastoma [ICD-11: 2A00.10] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
p53 signaling pathway | Activation | hsa04115 | ||
In Vitro Model | UW228 cells | Brain | Homo sapiens (Human) | CVCL_8585 |
R262 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU83 | |
R300 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU84 | |
UW426 cells | Bone marrow | Homo sapiens (Human) | CVCL_DH82 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Medulloblastoma | [1] | |||
Sensitive Disease | Medulloblastoma [ICD-11: 2A00.10] | |||
Sensitive Drug | Mitomycin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
p53 signaling pathway | Activation | hsa04115 | ||
In Vitro Model | UW228 cells | Brain | Homo sapiens (Human) | CVCL_8585 |
R262 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU83 | |
R300 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU84 | |
UW426 cells | Bone marrow | Homo sapiens (Human) | CVCL_DH82 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Nervous tissue | |
The Specified Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.10E-16; Fold-change: 1.21E-01; Z-score: 4.07E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem tissue | |
The Specified Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.53E-01; Fold-change: 2.54E-01; Z-score: 1.42E+00 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | White matter | |
The Specified Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.46E-02; Fold-change: -2.42E-01; Z-score: -4.59E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem tissue | |
The Specified Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.63E-02; Fold-change: -1.65E-01; Z-score: -7.88E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.