General Information of the Molecule (ID: Mol00108)
Name
Melanoma-associated antigen 6 (MAGEA6) ,Homo sapiens
Synonyms
Cancer/testis antigen 1.6; CT1.6; MAGE-6 antigen; MAGE3B antigen; MAGE6
    Click to Show/Hide
Molecule Type
Protein
Gene Name
MAGEA6
Gene ID
4105
Location
chrX:152766136-152769716[-]
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFAT
CLGLSYDGLLGDNQIMPKTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG
DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS
YPLLHEWALREGEE
    Click to Show/Hide
Function
Activator of ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases that acts as a as repressor of autophagy. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines.
    Click to Show/Hide
Uniprot ID
MAGA6_HUMAN
Ensembl ID
ENSG00000197172
HGNC ID
HGNC:6804
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Medulloblastoma [ICD-11: 2A00.10] [1]
Sensitive Disease Medulloblastoma [ICD-11: 2A00.10]
Sensitive Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Brain cancer [ICD-11: 2A00]
The Specified Disease Glioma
The Studied Tissue White matter
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 7.23E-01
Fold-change: -1.72E-02
Z-score: -3.60E-01
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
p53 signaling pathway Activation hsa04115
In Vitro Model UW228 cells Brain Homo sapiens (Human) CVCL_8585
R262 cells Bone marrow Homo sapiens (Human) CVCL_VU83
R300 cells Bone marrow Homo sapiens (Human) CVCL_VU84
UW426 cells Bone marrow Homo sapiens (Human) CVCL_DH82
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance.
Mitomycin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Medulloblastoma [ICD-11: 2A00.10] [1]
Sensitive Disease Medulloblastoma [ICD-11: 2A00.10]
Sensitive Drug Mitomycin
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
p53 signaling pathway Activation hsa04115
In Vitro Model UW228 cells Brain Homo sapiens (Human) CVCL_8585
R262 cells Bone marrow Homo sapiens (Human) CVCL_VU83
R300 cells Bone marrow Homo sapiens (Human) CVCL_VU84
UW426 cells Bone marrow Homo sapiens (Human) CVCL_DH82
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Nervous tissue
The Specified Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.99E-07; Fold-change: -1.05E-02; Z-score: -4.44E-02
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.31E-01; Fold-change: -8.95E-03; Z-score: -1.23E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specified Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.23E-01; Fold-change: -3.67E-03; Z-score: -1.08E-02
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem tissue
The Specified Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.03E-02; Fold-change: -3.38E-03; Z-score: -7.05E-03
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-34a confers chemosensitivity through modulation of MAGE-A and p53 in medulloblastoma. Neuro Oncol. 2011 Feb;13(2):165-75. doi: 10.1093/neuonc/noq179. Epub 2010 Dec 22.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.