Molecule Information
General Information of the Molecule (ID: Mol00099)
Name |
Interleukin-6 (IL6)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
IL-6; B-cell stimulatory factor 2; BSF-2; CTL differentiation factor; CDF; Hybridoma growth factor; Interferon beta-2; IFN-beta-2; IFNB2
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
IL6
|
||||
Gene ID | |||||
Location |
chr7:22725884-22732002[+]
|
||||
Sequence |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Click to Show/Hide
|
||||
Function |
Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Esophageal squamous cell carcinoma | [1] | |||
Sensitive Disease | Esophageal squamous cell carcinoma [ICD-11: 2B70.3] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
IL6/STAT3 signaling signaling pathway | Inhibition | hsa04659 | ||
In Vitro Model | TE8 cells | Esophageal | Homo sapiens (Human) | CVCL_1766 |
TE13 cells | Esophageal | Homo sapiens (Human) | CVCL_4463 | |
TE10 cells | Esophagus | Homo sapiens (Human) | CVCL_1760 | |
TE1 cells | Esophagus | Homo sapiens (Human) | CVCL_1759 | |
TE11 cells | Esophagus | Homo sapiens (Human) | CVCL_1761 | |
TE5 cells | Esophagus | Homo sapiens (Human) | CVCL_1764 | |
TE9 cells | Esophagus | Homo sapiens (Human) | CVCL_1767 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | Let-7c directly repressed cisplatin-activated interleukin (IL) -6/STAT3 prosurvival pathway, restored sensitivity to cisplatin and increased rate of apoptosis after exposure to cisplatin. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Renal cell carcinoma | [2] | |||
Resistant Disease | Renal cell carcinoma [ICD-11: 2C90.0] | |||
Resistant Drug | Sorafenib | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell cytotoxicity | Activation | hsa04650 | |
Tumorigenesis | Inhibition | hsa05200 | ||
In Vitro Model | 786-O cells | Kidney | Homo sapiens (Human) | CVCL_1051 |
A498 cells | Kidney | Homo sapiens (Human) | CVCL_1056 | |
Caki-2 cells | Kidney | Homo sapiens (Human) | CVCL_0235 | |
OSRC-2 cells | Kidney | Homo sapiens (Human) | CVCL_1626 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | Long noncoding RNA-SRLR elicits intrinsic sorafenib resistance via evoking IL-6/STAT3 axis in renal cell carcinoma. LncRNA-SRLR directly binds to NF-kB and promotes IL-6 transcription, leading to the activation of STAT3 and the development of sorafenib tolerance. |
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [3] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Platinum | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Caspase 3/7 cleavage assays; Aldefluor assay; MTS assay; Flow cytometric analysis | |||
Mechanism Description | Blocking the EZH2-interactiing domain of HOTAIR and disrupting the HOTAIR-EZH2 interaction resensitizes cancer cells to clinically relevant cytotoxic chemotherapies, reduces cell invasion and decreases NF-kB transcriptional activity and IL-6 and MMP-9 expression in vivo. Levels of genes like IL6 shown to be up-regulated by HOTAIR. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Esophagus | |
The Specified Disease | Esophageal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.38E-02; Fold-change: -3.84E+00; Z-score: -1.59E+00 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.49E-12; Fold-change: -2.64E-01; Z-score: -1.83E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.31E-08; Fold-change: -1.61E+00; Z-score: -1.03E+00 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Kidney | |
The Specified Disease | Kidney cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.23E-04; Fold-change: 4.48E-01; Z-score: 7.59E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.88E-05; Fold-change: 1.74E-01; Z-score: 2.54E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.