General Information of the Molecule (ID: Mol00076)
Name
GRB2-related adapter protein (GRAP) ,Homo sapiens
Molecule Type
Protein
Gene Name
GRAP
Gene ID
10750
Location
chr17:19020656-19047011[-]
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFR
RGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
    Click to Show/Hide
Function
Couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway. Plays a role in the inner ear and in hearing.
    Click to Show/Hide
Uniprot ID
GRAP_HUMAN
Ensembl ID
ENSG00000154016
HGNC ID
HGNC:4562
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Oral squamous cell carcinoma [1]
Resistant Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Resistant Drug Cisplatin
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation MAPK/RAS signaling pathway Regulation hsa04010
In Vitro Model Tca8113 cells Tongue Homo sapiens (Human) CVCL_6851
CAL-27 cells Tongue Homo sapiens (Human) CVCL_1107
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description miR654-5p targets GRAP to promote proliferation, metastasis, and chemoresistance of oral squamous cell carcinoma through Ras/MAPk signaling.
Fluorouracil
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Oral squamous cell carcinoma [1]
Resistant Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Resistant Drug Fluorouracil
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation MAPK/RAS signaling pathway Regulation hsa04010
In Vitro Model Tca8113 cells Tongue Homo sapiens (Human) CVCL_6851
CAL-27 cells Tongue Homo sapiens (Human) CVCL_1107
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description miR654-5p targets GRAP to promote proliferation, metastasis, and chemoresistance of oral squamous cell carcinoma through Ras/MAPk signaling.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Oral squamous cell carcinoma [ICD-11: 2B6E]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Oral tissue
The Specified Disease Oral squamous cell carcinoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.40E-04; Fold-change: -2.27E-01; Z-score: -7.92E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.71E-06; Fold-change: 1.94E-01; Z-score: 7.69E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-654-5p Targets GRAP to Promote Proliferation, Metastasis, and Chemoresistance of Oral Squamous Cell Carcinoma Through Ras/MAPK Signaling. DNA Cell Biol. 2018 Apr;37(4):381-388. doi: 10.1089/dna.2017.4095. Epub 2018 Jan 24.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.