Molecule Information

General Information of the Molecule (ID: Mol00074)

Name	Growth arrest-specific protein 7 (GAS7) ,Homo sapiens
Synonyms	GAS-7; KIAA0394 Click to Show/Hide
Molecule Type	Protein
Gene Name	GAS7
Gene ID	8522
Location	chr17:9910606-10198606[-]
Sequence	MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLL EKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGS HRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVT FPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEF IRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEV EKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIK LSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI Click to Show/Hide
Function	May play a role in promoting maturation and morphological differentiation of cerebellar neurons. Click to Show/Hide
Uniprot ID	GAS7_HUMAN
Ensembl ID	ENSG00000007237
HGNC ID	HGNC:4169
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Gefitinib

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Non-small cell lung cancer				[1]
Resistant Disease	Non-small cell lung cancer [ICD-11: 2C25.Y]			Disease Info
Resistant Drug	Gefitinib			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	AKT/ERK signaling pathway		Regulation	hsa04010
In Vitro Model	H1975 cells	Lung	Homo sapiens (Human)	CVCL_1511
	A549 cells	Lung	Homo sapiens (Human)	CVCL_0023
	PC9 cells	Lung	Homo sapiens (Human)	CVCL_B260
	PC9GR cells	Lung	Homo sapiens (Human)	CVCL_V337
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	Down-regulation of GAS7 expression could antagonize gefitinib re-sensitivity in PC9GR mediated by knockdown of miR181a via AkT/ERk pathways and epithelial-to-mesenchymal transition markers.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Lung cancer [ICD-11: 2C25]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Lung
The Specified Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.21E-48; Fold-change: -6.16E-01; Z-score: -1.46E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.86E-31; Fold-change: -6.43E-01; Z-score: -1.48E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	MiR-181a contributes gefitinib resistance in non-small cell lung cancer cells by targeting GAS7. Biochem Biophys Res Commun. 2018 Jan 22;495(4):2482-2489. doi: 10.1016/j.bbrc.2017.12.096. Epub 2017 Dec 18.