Molecule Information
General Information of the Molecule (ID: Mol00055)
| Name |
Deoxycytidylate deaminase (DCTD)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
dCMP deaminase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
DCTD
|
||||
| Gene ID | |||||
| Location |
chr4:182890060-182917936[-]
|
||||
| Sequence |
MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGC
SDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQA GIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Supplies the nucleotide substrate for thymidylate synthetase.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Triple negative breast cancer [ICD-11: 2C60.9] | [1] | |||
| Resistant Disease | Triple negative breast cancer [ICD-11: 2C60.9] | |||
| Resistant Drug | Gemcitabine | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Breast cancer [ICD-11: 2C60] | |||
| The Specified Disease | Breast cancer | |||
| The Studied Tissue | Breast tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.12E-02 Fold-change: -1.31E-02 Z-score: -2.55E+00 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 |
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
| Mechanism Description | Overexpression of microRNA-620 facilitates the resistance of triple negative breast cancer cells to gemcitabine treatment by targeting DCTD. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Breast tissue | |
| The Specified Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.12E-02; Fold-change: -1.84E-03; Z-score: -3.91E-03 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.99E-01; Fold-change: 3.88E-03; Z-score: 5.92E-03 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
