Molecule Information
General Information of the Molecule (ID: Mol00046)
Name |
Ceramide synthase 2 (CERS2)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
CerS2; LAG1 longevity assurance homolog 2; SP260; Sphingosine N-acyltransferase CERS2; Tumor metastasis-suppressor gene 1 protein; Very-long-chain ceramide synthase CERS2; LASS2; TMSG1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
CERS2
|
||||
Gene ID | |||||
Location |
chr1:150960583-150975003[-]
|
||||
Sequence |
MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYV
ATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYIRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSEGEEAAAGGGA KSRPLANGHPILNNNHRKND Click to Show/Hide
|
||||
Function |
Ceramide synthase that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27). N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides in de novo synthesis and salvage pathways, respectively. Plays a non-redundant role in the synthesis of ceramides with very-long-chain fatty acids in kidney, liver and brain. Regulates the abundance of myelin-specific sphingolipids galactosylceramide and sulfatide that affects myelin sheath architecture and motor neuron functions.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bladder cancer | [1] | |||
Resistant Disease | Bladder cancer [ICD-11: 2C94.0] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
Drp1 signaling pathway | Activation | hsa04668 | ||
In Vitro Model | 5637 cells | Bladder | Homo sapiens (Human) | CVCL_0126 |
J82 cells | Bladder | Homo sapiens (Human) | CVCL_0359 | |
RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 | |
SV-HUC-1 cells | Bladder | Homo sapiens (Human) | CVCL_3798 | |
T24 cells | Bladder | Homo sapiens (Human) | CVCL_0554 | |
Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
Experiment for Drug Resistance |
CCK8 assay; Colony formation assay; Flow cytometry assay | |||
Mechanism Description | microRNA-98 promotes drug resistance and regulates mitochondrial dynamics by targeting LASS2 in bladder cancer cells through Drp1 signaling. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bladder cancer | [1] | |||
Resistant Disease | Bladder cancer [ICD-11: 2C94.0] | |||
Resistant Drug | Doxorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
Drp1 signaling pathway | Activation | hsa04668 | ||
In Vitro Model | 5637 cells | Bladder | Homo sapiens (Human) | CVCL_0126 |
J82 cells | Bladder | Homo sapiens (Human) | CVCL_0359 | |
RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 | |
SV-HUC-1 cells | Bladder | Homo sapiens (Human) | CVCL_3798 | |
T24 cells | Bladder | Homo sapiens (Human) | CVCL_0554 | |
Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
Experiment for Drug Resistance |
CCK8 assay; Colony formation assay; Flow cytometry assay | |||
Mechanism Description | microRNA-98 promotes drug resistance and regulates mitochondrial dynamics by targeting LASS2 in bladder cancer cells through Drp1 signaling. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Bladder tissue | |
The Specified Disease | Bladder cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.37E-05; Fold-change: 3.31E-01; Z-score: 2.02E+00 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.