Molecule Information

General Information of the Molecule (ID: Mol01153)

Name	Tetracycline resistance protein TetU (TETU) ,Enterococcus faecium
Molecule Type	Protein
Gene Name	tetU
Sequence	MQLRRGKATDWHAMVQESLDSFASPHFLPIDIKPIDKIVIEGLIAEPSNWSIIARHTKYK YRNLLKQESQNDELTNHLRETFKESADELKKELDTWLLGLDVTEK Click to Show/Hide
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Lactobacillales Family: Enterococcaceae Genus: Enterococcus Species: Enterococcus faecium

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Tetracycline

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Enterococcus faecium meningitis			[1]
Resistant Disease	Enterococcus faecium meningitis [ICD-11: 1D01.2]		Disease Info
Resistant Drug	Tetracycline		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli		668369
	Enterococcus faecalis strain JH2-2		1320322
	Enterococcus faecium strain CH2		1352
Experiment for Molecule Alteration	DNA Hybridization assay
Experiment for Drug Resistance	Tube dilution method assay
Mechanism Description	PkQ10, a 1.9-kb plasmid carrying a novel Tc resistance determinant, was isolated from one of the isolates. The nucleotide sequence of this plasmid revealed an open reading frame corresponding to an 11.8-kDa protein and containing 105 amino acid residues. There was some limited similarity between this protein andtet(M),tet(O),tet(Q),tet(S),tetB(P), andotr(A), which overlapped, but did not include, the consensus GTP-binding sequences. The low-level, Tc-resistant determinant of pkQ10, namedtet(U), does not appear to correspond to any other known Tc resistance determinant.

References

Ref 1	A novel tetracycline-resistant determinant, tet(U), is encoded on the plasmid pKq10 in Enterococcus faecium. Plasmid. 1996 Mar;35(2):71-80. doi: 10.1006/plas.1996.0009.