Molecule Information

General Information of the Molecule (ID: Mol01113)

• Name: Tetracycline resistance protein TetQ (TETQ) ,Bacteroides sp.(Bacteroides coprosuis)
• Molecule Type: Protein
• Gene Name: tet(36)
• Sequence:
  MRTINIGILAHIDAGKTSITENLLFASGATIVRGSVDKGNTTTDSMDIEKRRGITVRAST
  TSIQWNDTKINIIDTPGHMDFLAEVERTFRMLDGAILVVSAKEGIQAQTRLLFNVLQQLE
  IPTILFVNKIDREGVNLNQLYLEIQNSLSKDIIFMQSVEGKELTSSCTIHYISEKNRETI
  LEKDDLLLEKYLSDTQLSNLDYWNSMVRLVQAAKLHPIYHGSAMYGIGIEDLLNSITTFI
  ETSLPQENALSAYVYKIEHNKKEQKRAYLKIIGGTLKSRKLYSLNGSDENLKIRGLKTFY
  SGDEIDVDEVFTNDIAIADHADNLMVGDYLGIMPNLFDKLNIPSPALKSSIHPAKVENRS
  KLISAMNVLSVEDPSLAFSINADNNELEVSLYGATQREVILTLLEERFSVDAYFEEVKTI
  YKERLKTKSEYTIHIEVPPNPYWASIGLIIEPLPIGAGLVMESEISLGYLNRSFQNAVFD
  GVKKACESGLYGWEVTDLKVTFSHGIYYSPVSTPADFRSLAPYVFRLALQQADVELLEPI
  LDFKLQIPLAVNARAITDINKMQGEISTITSDGDWTTILGNIPLDTSKEYSAEVSSYTQG
  LGVFVTRFSGYRPTNKKVSRSVELNEKDKLMYMFEKESIK
• Function: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
• Uniprot ID: Q7WT01_9BACE

Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Bacteroidaceae
Genus: Bacteroides
Species: Bacteroides coprosuis

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 6 drug(s) in total

Chlortetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacteroides spp infection [1]

• Resistant Disease: Bacteroides spp infection [ICD-11: 1C4Y.9]
• Resistant Drug: Chlortetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• Experiment for Molecule Alteration: PCR; Dot blot and Southern blot analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.

Demeclocycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacteroides spp infection [1]

• Resistant Disease: Bacteroides spp infection [ICD-11: 1C4Y.9]
• Resistant Drug: Demeclocycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• Experiment for Molecule Alteration: PCR; Dot blot and Southern blot analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.

Doxycycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacteroides spp infection [1]

• Resistant Disease: Bacteroides spp infection [ICD-11: 1C4Y.9]
• Resistant Drug: Doxycycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• Experiment for Molecule Alteration: PCR; Dot blot and Southern blot analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.

Minocycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacteroides spp infection [1]

• Resistant Disease: Bacteroides spp infection [ICD-11: 1C4Y.9]
• Resistant Drug: Minocycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• Experiment for Molecule Alteration: PCR; Dot blot and Southern blot analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.

Oxytetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacteroides spp infection [1]

• Resistant Disease: Bacteroides spp infection [ICD-11: 1C4Y.9]
• Resistant Drug: Oxytetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• Experiment for Molecule Alteration: PCR; Dot blot and Southern blot analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.

Tetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacteroides spp infection [1]

• Resistant Disease: Bacteroides spp infection [ICD-11: 1C4Y.9]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• Experiment for Molecule Alteration: PCR; Dot blot and Southern blot analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Tet36 is a new class of ribosome protection type tetracycline resistance protein and lead to drug resistance.

References

• Ref 1: Identification of a new ribosomal protection type of tetracycline resistance gene, tet(36), from swine manure pits. Appl Environ Microbiol. 2003 Jul;69(7):4151-8. doi: 10.1128/AEM.69.7.4151-4158.2003.