Molecule Information

General Information of the Molecule (ID: Mol01097)

• Name: Streptothricin N-acetyltransferase Sat4 (SAT4) ,Campylobacter coli
• Synonyms: dhps; EC 2.5.1.15; Fragment
• Molecule Type: Protein
• Gene Name: sat4
• Sequence:
  MITEMKAGHLKDIDKPSEPFEVIGKIIPRYENENWTFTELLYEAPYLKSYQDEEDEEDEE
  ADCLEYIDNTDKIIYLYYQDDKCVGKVKLRKNWNRYAYIEDIAVCKDFRGQGIGSALINI
  SIEWAKHKNLHGLMLETQDNNLIACKFYHNCGFKIGSVDTMLYANFENNFEKAVFWYLRF
  FVIISFLGYL
• Uniprot ID: A0A7H0XIR7_CAMCO

Kingdom: N.A.
Phylum: Proteobacteria
Class: Epsilonproteobacteria
Order: Campylobacterales
Family: Campylobacteraceae
Genus: Campylobacter
Species: Campylobacter coli

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Investigative Drug(s) 1 drug(s) in total

Streptothricin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Streptothricin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Campylobacter coli strain BE/G4; 195
• In Vitro Model: Campylobacter coli strain BE5698; 195
• In Vitro Model: Campylobacter coli strain BE6361; 195
• In Vitro Model: Campylobacter coli strain BM2509; 195
• In Vitro Model: Campylobacter coli strain Ck196; 195
• In Vitro Model: Campylobacter coli strain Ck197; 195
• In Vitro Model: Campylobacter coli strain Ck199; 195
• In Vitro Model: Campylobacter coli strain Ck204; 195
• In Vitro Model: Campylobacter jejuni strain Ck194; 197
• In Vitro Model: Escherichia coli strain SURE; 562
• In Vitro Model: Escherichia coli strain SURE (pAT132); 562
• Experiment for Molecule Alteration: SDS-polyacrylamide gel assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: The sat 4 streptothricin resistance gene from Campylobacter coli BE/G4 was cloned into pUC18, and its nucleotide sequence was determined. Streptothricin acetyltransferase activity was detected in Escherichia coli cells containing recombinant plasmid pAT132 which carries the sat4 gene as an insert. The deduced amino acid sequence displayed 21-27% amino acid identity with streptothricin acetyltransferases from Escherichia coli and streptothricin producers Streptomyces lavendulae and Streptomyces noursei. The sat 4 gene was detected by hybridization in clinical and environmental isolates of Campylobacter spp.

References

• Ref 1: Characterization of the sat4 gene encoding a streptothricin acetyltransferase in Campylobacter coli BE/G4. FEMS Microbiol Lett. 1994 Jul 1;120(1-2):13-7. doi: 10.1111/j.1574-6968.1994.tb07000.x.