Molecule Information

General Information of the Molecule (ID: Mol01077)

• Name: rRNA adenine N-6-methyltransferase ermG (ERMG) ,Bacillus sphaericus
• Synonyms: Erythromycin resistance protein; Macrolide-lincosamide-streptogramin B resistance protein
• Molecule Type: Protein
• Gene Name: ermG
• Gene ID: 60292698
• Sequence:
  MNKVNIKDSQNFITSKYHIEKIMNCISLDEKDNIFEIGAGKGHFTAELVKRCNFVTAIEI
  DSKLCEVTRNKLLNYPNYQIVNDDILKFTFPSHNPYKIFGSIPYNISTNIIRKIVFESSA
  TISYLIVEYGFAKRLLDTNRSLALLLMAEVDISILAKIPRYYFHPKPKVDSALIVLKRKP
  AKMAFKERKKYETFVMKWVNKEYEKLFTKNQFNKALKHARIYDINNISFEQFVSLFNSYK
  IFNG
• Function: Involved in erythromycin resistance.
• Uniprot ID: ERMG_LYSSH

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Lysinibacillus
Species: Lysinibacillus sphaericus

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Erythromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus sphaericus infection [1]

• Resistant Disease: Bacillus sphaericus infection [ICD-11: 1C4Y.4]
• Resistant Drug: Erythromycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Bacillus subtilis strain BD1107; 1423
• In Vitro Model: Bacillus subtilis strain BD1117; 1423
• In Vitro Model: Bacillus subtilis strain BD1146; 1423
• In Vitro Model: Bacillus subtilis strain BD1156; 1423
• In Vitro Model: Bacillus subtilis strain BD1158; 1423
• In Vitro Model: Bacillus subtilis strain BD624; 1423
• In Vitro Model: Bacillus subtilis strain BD629; 1423
• In Vitro Model: Bacillus subtilis strain BD630; 1423
• In Vitro Model: Bacillus subtilis strain CU403; 1423
• Experiment for Molecule Alteration: Southern blotting assay
• Mechanism Description: One of the mechanisms of bacterial resistance to aminoglycosides is the production of aminoglycoside N-acetyl-transferase (AAC) enzymes which acetylate the amino groups present in the molecule of the aminoglycoside, preventing their interaction with the ribosome. ermG specifies a 29,000-dalton protein, the synthesis of which is induced by erythromycin. S1 nuclease mapping was used to identify the transcriptional start site. These experiments demonstrated the presence on the ermG mRNA of a 197 to 198-base leader.

Macrolides

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacillus sphaericus infection [1]

• Resistant Disease: Bacillus sphaericus infection [ICD-11: 1C4Y.4]
• Resistant Drug: Macrolides
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Bacillus subtilis strain BD1107; 1423
• In Vitro Model: Bacillus subtilis strain BD1117; 1423
• In Vitro Model: Bacillus subtilis strain BD1146; 1423
• In Vitro Model: Bacillus subtilis strain BD1156; 1423
• In Vitro Model: Bacillus subtilis strain BD1158; 1423
• In Vitro Model: Bacillus subtilis strain BD624; 1423
• In Vitro Model: Bacillus subtilis strain BD629; 1423
• In Vitro Model: Bacillus subtilis strain BD630; 1423
• In Vitro Model: Bacillus subtilis strain CU403; 1423
• Experiment for Molecule Alteration: Southern blotting assay
• Mechanism Description: One of the mechanisms of bacterial resistance to aminoglycosides is the production of aminoglycoside N-acetyl-transferase (AAC) enzymes which acetylate the amino groups present in the molecule of the aminoglycoside, preventing their interaction with the ribosome. ermG specifies a 29,000-dalton protein, the synthesis of which is induced by erythromycin. S1 nuclease mapping was used to identify the transcriptional start site. These experiments demonstrated the presence on the ermG mRNA of a 197 to 198-base leader.

References

• Ref 1: Cloning and analysis of ermG, a new macrolide-lincosamide-streptogramin B resistance element from Bacillus sphaericus. J Bacteriol. 1987 Jan;169(1):340-50. doi: 10.1128/jb.169.1.340-350.1987.