Molecule Information

General Information of the Molecule (ID: Mol01074)

Name	rRNA adenine N-6-methyltransferase ermC' (ERMC) ,Bacillus subtilis
Synonyms	Erythromycin resistance protein; Macrolide-lincosamide-streptogramin B resistance protein Click to Show/Hide
Molecule Type	Protein
Gene Name	ermC'
Sequence	MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIRKIVFDSIA DEIYLIVEYGFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK SRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYK LFNK Click to Show/Hide
Function	This protein produces a dimethylation of the adenine residue at position 2085 in 23S rRNA, resulting in reduced affinity between ribosomes and macrolide-lincosamide-streptogramin B antibiotics. Click to Show/Hide
Uniprot ID	ERM_BACIU
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Bacillales Family: Bacillaceae Genus: Bacillus Species: Bacillus subtilis

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Erythromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Erythromycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Bacillus subtilis strain BD170		1423
	Bacillus subtilis strain BD430		1423
	Bacillus subtilis strain BD431		1423
	Bacillus subtilis strain BD488		1423
	Bacillus subtilis strain BD81		1423
Experiment for Molecule Alteration	SDS-PAGE assay
Mechanism Description	The ermC gene of plasmid pE194 specifies resistance to the macrolidelincosamide-streptogramin B antibiotics. pE194 specifies an RNA methylase that can utilize either 50 S ribosomes or 23 S rRNA as substrates,with a specific dimethylation of adenine in 23 S rRNA.

Macrolides

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Macrolides		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Bacillus subtilis strain BD170		1423
	Bacillus subtilis strain BD430		1423
	Bacillus subtilis strain BD431		1423
	Bacillus subtilis strain BD488		1423
	Bacillus subtilis strain BD81		1423
Experiment for Molecule Alteration	SDS-PAGE assay
Mechanism Description	The ermC gene of plasmid pE194 specifies resistance to the macrolidelincosamide-streptogramin B antibiotics. pE194 specifies an RNA methylase that can utilize either 50 S ribosomes or 23 S rRNA as substrates,with a specific dimethylation of adenine in 23 S rRNA.

References

Ref 1	Molecular mechanism of drug-dependent ribosome stalling. Mol Cell. 2008 Apr 25;30(2):190-202. doi: 10.1016/j.molcel.2008.02.026.
Ref 2	The ermC leader peptide: amino acid alterations leading to differential efficiency of induction by macrolide-lincosamide-streptogramin B antibiotics. J Bacteriol. 1990 Jul;172(7):3772-9. doi: 10.1128/jb.172.7.3772-3779.1990.
Ref 3	Mono- and dimethylating activities and kinetic studies of the ermC 23 S rRNA methyltransferase. J Biol Chem. 1989 Feb 15;264(5):2615-24.