Molecule Information

General Information of the Molecule (ID: Mol01071)

• Name: Ribosomal tetracycline resistance protein tet(44) (TET44) ,Campylobacter fetus subsp. fetus
• Synonyms: aacC1; RCS36_PI-II0023; 3)-I); EC 2.3.1.60
• Molecule Type: Protein
• Gene Name: tet(44)
• Sequence:
  MKIINIGILAHVDAGKTTLTESLLYTSGAILELGSVDKGTTRTDTMFLERQRGITIQAAV
  TSFNWNDYKINIVDTPGHTDFITEVYRSLSVLDGAILVISAKDGVQAQTRILFHALQKMN
  IPTIIFINKIDQDGINLNNIYQNIKEKLSNDIIVMQNVTLTPEISIKNIIDLDDWDPVIS
  KNDKLLEKYIVGEKLTIQELMYEEYRCVKKGSLFPIYHGSARNNIGTQQLIEAISNLFCS
  EMNENDSELCGRVFKIEYTDHKQRLVYLRLYSGTLHLRDTIILPEKKKVKLTEIYIPSNG
  EMIQTKTVCSGDIFIIPNNTLRLNDIIGNEKLLPCNVWNDKTVPILRTRIEPIKIEEREK
  LLDALTEIADTDPLLRYYVDTITHEIIISFLGTVQLEVICSLLIEKYHINIRIEDPTVIY
  LEKPLQKADYTIHIEVPPNPFWASIGLSITPLPIGSGIQYESKVSLGYLNQSFQNAVREG
  INYGLEQGLYGWEVTDCKICFEYGVYYSPVSTPSDFRFLAPIVLEQTLKKAGTQLLEPYL
  SFILFTPQGYFSRAYKDAQKHCAIIETSQSKNDEVIFTGHIPVRCINEYRNTLTLYTNGQ
  AVFLTELKDYQIATCEPVIQSRRPNNRIDKVRHMFNKKEN
• Uniprot ID: D8L9Y9_CAMFE

Kingdom: N.A.
Phylum: Proteobacteria
Class: Epsilonproteobacteria
Order: Campylobacterales
Family: Campylobacteraceae
Genus: Campylobacter
Species: Campylobacter fetus subsp. fetus

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Doxycycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Doxycycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli S17-1 Lambdapir; 1227813
• Experiment for Molecule Alteration: Illumina/Solexa sequencing assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: The 640-amino-acid tetracycline resistance determinant, Tet 44, belongs to a class of proteins that confers resistance to tetracycline and minocycline by ribosomal protection.

Minocycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Minocycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli S17-1 Lambdapir; 1227813
• Experiment for Molecule Alteration: Illumina/Solexa sequencing assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: The 640-amino-acid tetracycline resistance determinant, Tet 44, belongs to a class of proteins that confers resistance to tetracycline and minocycline by ribosomal protection.

Tetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Campylobacter fetus infection [1]

• Resistant Disease: Campylobacter fetus infection [ICD-11: 1C40.0]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli S17-1 Lambdapir; 1227813
• Experiment for Molecule Alteration: Illumina/Solexa sequencing assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: The 640-amino-acid tetracycline resistance determinant, Tet 44, belongs to a class of proteins that confers resistance to tetracycline and minocycline by ribosomal protection.

References

• Ref 1: Two novel antibiotic resistance genes, tet(44) and ant(6)-Ib, are located within a transferable pathogenicity island in Campylobacter fetus subsp. fetus. Antimicrob Agents Chemother. 2010 Jul;54(7):3052-5. doi: 10.1128/AAC.00304-10. Epub 2010 May 17.