Molecule Information

General Information of the Molecule (ID: Mol01062)

• Name: Quinolone efflux pump (QEPA2) ,Escherichia coli
• Synonyms: qepA2; Quinolone efflux pump
• Molecule Type: Protein
• Gene Name: qepA2
• Sequence:
  MSATLHDTAADRRKATRREWIGLAVVALPCLVYAMDLTVLNLALPVLSRELQPSSAQLLW
  ILDIYGFFVAGFLITMGTLGDRIGRRRLLLIGAAFFAFGSVLAALADTAALLIAARALLG
  LAGATIAPSTMALIRNMFHDPRQRQFAIGVWIAAFSLGSAIGPLVGGVLLEFFHWGAVFW
  LNVPVMLLTLALGPRFLPEYRDPDAGHLDLASVLLSLAAVLLTIYGLKQLAEHGAGLASM
  AALLAGLAVGALFLRRQGHIAYPLLDLRLFAHAPFRAALAAYALAALAMFGVYIFMTQYL
  QLVLGLSPLQAGLATLPWSLCFVIGSLLSPQLAARWPAARILVVGLSAAAFGFAVLGLGQ
  GLWWLVPATIVMGLGLAPVFTIGNEIIITSAPSERAGAASALSETVSEFSGALGIALFGS
  VGLVVYRQALTSAALPGLPADALQAAGASLGGAVHLADTLPAWQGAALLAAARAGFTDAL
  QATAWAGAVLVLVAAGLVARLLRKRPALASG
• Uniprot ID: B5AG18_ECOLX

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Ciprofloxacin XR

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Ciprofloxacin XR
• Molecule Alteration: Missense mutation; p.A99G+p.V134I
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Disk diffusion assay
• Mechanism Description: QepA confers decreased susceptibility to hydrophilic fluoroquinolones (e.g., norfloxacin, ciprofloxacin, and enrofloxacin) with a 32- to 64-fold increase of MICs.

Moxifloxacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Moxifloxacin
• Molecule Alteration: Missense mutation; p.A99G+p.V134I
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Disk diffusion assay
• Mechanism Description: QepA confers decreased susceptibility to hydrophilic fluoroquinolones (e.g., norfloxacin, ciprofloxacin, and enrofloxacin) with a 32- to 64-fold increase of MICs.

Norfloxacin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Norfloxacin
• Molecule Alteration: Missense mutation; p.A99G+p.V134I
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Experiment for Drug Resistance: Disk diffusion assay
• Mechanism Description: QepA confers decreased susceptibility to hydrophilic fluoroquinolones (e.g., norfloxacin, ciprofloxacin, and enrofloxacin) with a 32- to 64-fold increase of MICs.

References

• Ref 1: Plasmid-mediated quinolone resistance pump QepA2 in an Escherichia coli isolate from France. Antimicrob Agents Chemother. 2008 Oct;52(10):3801-4. doi: 10.1128/AAC.00638-08. Epub 2008 Jul 21.