Molecule Information

General Information of the Molecule (ID: Mol01027)

Name	OmpK37 (OMPK37) ,Klebsiella pneumoniae
Synonyms	ompK37; ompN_1; ompN_2; ompS2; A7B01_14055; BANRA_00477; C3F39_02150; DDJ63_15275; FXN67_16010; G5637_10005; NCTC11679_03052; NCTC13465_01341; NCTC13635_00771; SAMEA3499901_03301; SAMEA3649733_02328; SAMEA3727643_03097; SAMEA3729663_03401; SAMEA4873619_03663; Outer membrane pore protein N; non-specific; Outer membrane protein N; Porin; Porin OmpK37; Porin OmpS2 Click to Show/Hide
Molecule Type	Protein
Gene Name	ompK37
Sequence	MKRKVLALVIPALLAAGAAHAAEIYNKDGNKLDLYGKVDGLHYFSSDSKKDGDQTYLRFG FKGETQINDMLTGYGQWEYNVQANNTETSSDQAWTRLAFAGIKVGDYGSFDYGRNYGVLY DVEGWTDMLPEFGGDSYTYADNFMAGRANGVATYRNSDFFGLVEGLNFALQYQGKNEGQN AQDINVGTNNRSSDSDVRFDNGDGFGLSTSYDFGMGISAAAAYTSSDRTNDQMTQTNARG DKAEAWTAGLKYDANDIYLATMYSETRNMTPYGNDGVANKTQNFEVTAQYQFDFGLRPAI SYLQSKGKDLYNNGRYADKDLVKYMDVGATYYFNRNMSTYVDYKINLLDGNDKFYEDNGI STDNIVALGLVYQF Click to Show/Hide
Uniprot ID	S5UCA2_KLEPN
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Klebsiella Species: Klebsiella pneumoniae

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

4 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cefotaxime

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Klebsiella pneumoniae infection			[1]
Sensitive Disease	Klebsiella pneumoniae infection [ICD-11: CA40.1]		Disease Info
Sensitive Drug	Cefotaxime		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli		668369
	Klebsiella pneumoniae strain CSUB10R		573
	Klebsiella pneumoniae strain CSUB10S		573
	Klebsiella pneumoniae strain LB4		573
	Klebsiella pneumoniae strain LB66		573
	Klebsiella pneumoniae strain SD8		573
Experiment for Molecule Alteration	Southern blotting assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	Due to its porin deficiency, strain CSUB10R is more resistant to Beta-lactams than is parental strain CSUB10S. As expected, for k. pneumoniae CSUB10R expressing Ompk36 or Ompk35, the MICs reverted to values similar to those observed for strain CSUB10S.

Cefoxitin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Klebsiella pneumoniae infection			[1]
Sensitive Disease	Klebsiella pneumoniae infection [ICD-11: CA40.1]		Disease Info
Sensitive Drug	Cefoxitin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli		668369
	Klebsiella pneumoniae strain CSUB10R		573
	Klebsiella pneumoniae strain CSUB10S		573
	Klebsiella pneumoniae strain LB4		573
	Klebsiella pneumoniae strain LB66		573
	Klebsiella pneumoniae strain SD8		573
Experiment for Molecule Alteration	Southern blotting assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	Due to its porin deficiency, strain CSUB10R is more resistant to Beta-lactams than is parental strain CSUB10S. As expected, for k. pneumoniae CSUB10R expressing Ompk36 or Ompk35, the MICs reverted to values similar to those observed for strain CSUB10S.

Meropenem

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Klebsiella pneumoniae infection			[1]
Sensitive Disease	Klebsiella pneumoniae infection [ICD-11: CA40.1]		Disease Info
Sensitive Drug	Meropenem		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli		668369
	Klebsiella pneumoniae strain CSUB10R		573
	Klebsiella pneumoniae strain CSUB10S		573
	Klebsiella pneumoniae strain LB4		573
	Klebsiella pneumoniae strain LB66		573
	Klebsiella pneumoniae strain SD8		573
Experiment for Molecule Alteration	Southern blotting assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	Due to its porin deficiency, strain CSUB10R is more resistant to Beta-lactams than is parental strain CSUB10S. As expected, for k. pneumoniae CSUB10R expressing Ompk36 or Ompk35, the MICs reverted to values similar to those observed for strain CSUB10S.

Imipenem

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Klebsiella pneumoniae infection			[1]
Sensitive Disease	Klebsiella pneumoniae infection [ICD-11: CA40.1]		Disease Info
Sensitive Drug	Imipenem		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli		668369
	Klebsiella pneumoniae strain CSUB10R		573
	Klebsiella pneumoniae strain CSUB10S		573
	Klebsiella pneumoniae strain LB4		573
	Klebsiella pneumoniae strain LB66		573
	Klebsiella pneumoniae strain SD8		573
Experiment for Molecule Alteration	Southern blotting assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	Due to its porin deficiency, strain CSUB10R is more resistant to Beta-lactams than is parental strain CSUB10S. As expected, for k. pneumoniae CSUB10R expressing Ompk36 or Ompk35, the MICs reverted to values similar to those observed for strain CSUB10S.

References

Ref 1	Identification and characterization of a new porin gene of Klebsiella pneumoniae: its role in beta-lactam antibiotic resistance. J Bacteriol. 1999 May;181(9):2726-32. doi: 10.1128/JB.181.9.2726-2732.1999.