Molecule Information

General Information of the Molecule (ID: Mol01025)

• Name: Oleandomycin glycosyltransferase oleD (OLED) ,Streptomyces antibioticus
• Synonyms: UGT102A2
• Molecule Type: Protein
• Gene Name: oleD
• Sequence:
  MTTQTTPAHIAMFSIAAHGHVNPSLEVIRELVARGHRVTYAIPPVFADKVAATGPRPVLY
  HSTLPGPDADPEAWGSTLLDNRRTFLNDAIQALPQLADAYADDIPDLVLHDITSYPARVL
  ARRWGVPAVSLSPNLVAWKGYEEEVAEPMWREPRQTERGRAYYARFEAWLKENGITEHPD
  TFASHPPRSLVLIPKALQPHADRVDEDVYTFVGACQGDRAEEGGWQRPAGAEKVVLVSLG
  SAFTKQPAFYRECVRAFGNLPGWHLVLQIGRKVTPAELGELPDNVEVHDWVPQLAILRQA
  DLFVTHAGAGGSQEGLATATPMIAVPQAVDQFGNADMLQGLGVARKLATEEATADLLRET
  ALALVDDPEVARRLRRIQAEMAQEGGTRRAADLIEAELPARHERQEPVGDRPNVGDRPAG
  VRSDRQRSAL
• Function: Specifically inactivates oleandomycin via 2'-O-glycosylation using UDP-glucose.
• Uniprot ID: OLED_STRAT

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces antibioticus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Erythromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptomyces infection [1]

• Resistant Disease: Streptomyces infection [ICD-11: 1C43.6]
• Resistant Drug: Erythromycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli C41(DE3); 469008
• Experiment for Molecule Alteration: Linked enzyme activity assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Glycosylation of macrolide antibiotics confers host cell immunity from endogenous and exogenous agents. The Streptomyces antibioticus glycosyltransferases, OleD, diverse macrolides including erythromycin.

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Erythromycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli GT-28; 562
• In Vitro Model: Escherichia coli MurG; 562
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: OleD displays broad acceptor specificity and hence will inactivate a wider range of macrolide antibiotics including tylosin and erythromycin.

Macrolides

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Macrolides
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli GT-28; 562
• In Vitro Model: Escherichia coli MurG; 562
• Experiment for Molecule Alteration: Whole genome sequence assay
• Mechanism Description: OleD displays broad acceptor specificity and hence will inactivate a wider range of macrolide antibiotics including tylosin and erythromycin.

References

• Ref 1: The crystal structure of two macrolide glycosyltransferases provides a blueprint for host cell antibiotic immunity. Proc Natl Acad Sci U S A. 2007 Mar 27;104(13):5336-41. doi: 10.1073/pnas.0607897104. Epub 2007 Mar 21.
• Ref 2: Glycosylation of macrolide antibiotics. Purification and kinetic studies of a macrolide glycosyltransferase from Streptomyces antibioticus. J Biol Chem. 2000 Apr 21;275(16):11713-20. doi: 10.1074/jbc.275.16.11713.
• Ref 3: Characterization of a Streptomyces antibioticus gene cluster encoding a glycosyltransferase involved in oleandomycin inactivation. Gene. 1993 Nov 30;134(1):139-40. doi: 10.1016/0378-1119(93)90189-a.