Molecule Information

General Information of the Molecule (ID: Mol01016)

Name	Multidrug resistance protein MdtK (MDTK) ,Salmonella enterica serovar Typhimurium
Synonyms	Multidrug-efflux transporter; norM; STM1425 Click to Show/Hide
Molecule Type	Protein
Gene Name	mdtK
Gene ID	1252943
Sequence	MQKYTSEARQLLALRIPVILAQVAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILF GHGLLLALTPVIAQLNGSGRRERIAHQVRQGFWLAGFVSVLVMIVLWNAGYIIRSMHNID PALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFLGLLVNIPVNYIFIY GHFGMPELGGIGCGVATAAVYWVMFIAMLSYIKHARSMRDIRNEKGFGKPDSVVMKRLIQ LGLPIALALFFEVTLFAVVALLVSPLGIVDVAGHQIALNFSSLMFVLPMSLAAAVTIRVG YRLGQGSTLDAQTAARTGLGVGICMAVVTAIFTVTLRKHIALLYNDNPEVVALAAQLMLL AAVYQISDSIQVIGSGILRGYKDTRSIFFITFTAYWVLGLPSGYILALTDLVVDRMGPAG FWMGFIIGLTSAAVLMMLRMRYLQRQPSAIILQRAAR Click to Show/Hide
Function	Multidrug efflux pump that functions probably as a Na(+)/drug antiporter. Click to Show/Hide
Uniprot ID	MDTK_SALTY
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Salmonella Species: Salmonella enterica subsp. enterica serovar Typhimurium

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Acriflavine

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Salmonella enterica infection			[1]
Resistant Disease	Salmonella enterica infection [ICD-11: 1A09.0]		Disease Info
Resistant Drug	Acriflavine		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Salmonella enterica serovar Typhimurium ATCC 14028s		588858
Experiment for Molecule Alteration	Quantitative real-time PCR
Experiment for Drug Resistance	L agar plate method assay
Mechanism Description	Overexpression or overproduction of mdtk confers drug resistance.

Doxorubicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Salmonella enterica infection			[1]
Resistant Disease	Salmonella enterica infection [ICD-11: 1A09.0]		Disease Info
Resistant Drug	Doxorubicin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Salmonella enterica serovar Typhimurium ATCC 14028s		588858
Experiment for Molecule Alteration	Quantitative real-time PCR
Experiment for Drug Resistance	L agar plate method assay
Mechanism Description	Overexpression or overproduction of mdtk confers drug resistance.

Norfloxacin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Salmonella enterica infection			[1]
Resistant Disease	Salmonella enterica infection [ICD-11: 1A09.0]		Disease Info
Resistant Drug	Norfloxacin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Salmonella enterica serovar Typhimurium ATCC 14028s		588858
Experiment for Molecule Alteration	Quantitative real-time PCR
Experiment for Drug Resistance	L agar plate method assay
Mechanism Description	Overexpression or overproduction of mdtk confers drug resistance.

References

Ref 1	Virulence and drug resistance roles of multidrug efflux systems of Salmonella enterica serovar Typhimurium. Mol Microbiol. 2006 Jan;59(1):126-41. doi: 10.1111/j.1365-2958.2005.04940.x.