Molecule Information

General Information of the Molecule (ID: Mol00991)

Name	Macrolide 2'-phosphotransferase II (MPHB) ,Escherichia coli
Synonyms	mphB; mph(B); BON70_03915; DAH50_23490; GF147_25890; GF147_27035; HVY77_26855; pO103_99; B) family macrolide 2'-phosphotransferase Click to Show/Hide
Molecule Type	Protein
Gene Name	mphB
Sequence	MSKDIKQVIEIAKKHNLFLKEETIQFNESGLDFQAVFAQDNNGIDWVLRLPRREDVMPRT KVEKQALDLVNKYAISFQAPNWIIYTEELIAYKKLDGVPAGTIDHNIGNYIWEIDINNVP ELFHKSLGRVLAELHSIPSNKAAALDLVVHTPEEARMSMKQRMDAVRAKFGVGENLWNRW QAWLNDDDMWPKKTGLIHGDVHAGHTMIDKDANVTGLIDWTEAKVTDVSHDFIFNYRAFG EEGLEALILAYKEIGGYYWPKMKEHIIELNAAYPVSIAEFALVSGIEEYEQMAKEALEVQ GS Click to Show/Hide
Uniprot ID	O32553_ECOLX
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Erythromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Erythromycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli AG100A		562
	Escherichia coli DB10		562
	Escherichia coli TOP10		83333
	Escherichia coli XL1-Blue		562
	Staphylococcus aureus RN4220		1280
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	Mph enzymes inactivate macrolides by phosphorylating the 2'-OH of the essential dimethylamino sugar, preventing it from binding the ribosome, and providing the chemical rationale for the resistance phenotype.

Spiramycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Spiramycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli AG100A		562
	Escherichia coli DB10		562
	Escherichia coli TOP10		83333
	Escherichia coli XL1-Blue		562
	Staphylococcus aureus RN4220		1280
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	Mph enzymes inactivate macrolides by phosphorylating the 2'-OH of the essential dimethylamino sugar, preventing it from binding the ribosome, and providing the chemical rationale for the resistance phenotype.

Telithromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Telithromycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli AG100A		562
	Escherichia coli DB10		562
	Escherichia coli TOP10		83333
	Escherichia coli XL1-Blue		562
	Staphylococcus aureus RN4220		1280
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	Mph enzymes inactivate macrolides by phosphorylating the 2'-OH of the essential dimethylamino sugar, preventing it from binding the ribosome, and providing the chemical rationale for the resistance phenotype.

References

Ref 1	Purification and characterization of macrolide 2'-phosphotransferase type II from a strain of Escherichia coli highly resistant to macrolide antibiotics. FEMS Microbiol Lett. 1992 Oct 1;76(1-2):89-94. doi: 10.1016/0378-1097(92)90369-y.
Ref 2	Resistance phenotypes conferred by macrolide phosphotransferases. FEMS Microbiol Lett. 2007 Apr;269(2):317-22. doi: 10.1111/j.1574-6968.2007.00643.x. Epub 2007 Feb 16.
Ref 3	The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. Nat Commun. 2018 Jan 9;9(1):112. doi: 10.1038/s41467-017-02680-0.