Molecule Information
General Information of the Molecule (ID: Mol00959)
Name |
Erythromycin resistance protein (ERM33)
,Staphylococcus sciuri
|
||||
---|---|---|---|---|---|
Synonyms |
Macrolide-lincosamide-streptogramin B resistance protein; rRNA adenine N-6-methyltransferase; erm33
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
erm(33)
|
||||
Sequence |
MNKKNIKDSQNFITSKRNIDKIMTNISLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYNIFGNIPYNISTDIVKRITFESQA KYSYLIVEKGFAKRLQNLQRALGLLLMVEMDIKMLKKVPPLYFHPKPSVDSVLIVLERHQ PLISKKDYKKYRSFVYKWVNREYRVLFTKNQFRQALKHANVTNINKLSKEQFLSIFNSYK LFH Click to Show/Hide
|
||||
Function |
This protein produces a dimethylation of the adenine residue at position 2085 in 23S rRNA, resulting in reduced affinity between ribosomes and macrolide-lincosamide-streptogramin B antibiotics.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Macrolides
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Staphylococcus sciuri infection | [1] | |||
Resistant Disease | Staphylococcus sciuri infection [ICD-11: 1B54.1] | |||
Resistant Drug | Macrolides | |||
Molecule Alteration | Expression | Gene recombination |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus sciuri plasmid pSCFS1 | 1296 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Staphylococcus sciuri Gene erm(33), Encoding Inducible Resistance to Macrolides, Lincosamides, and Streptogramin B Antibiotics, Is a Product of Recombination between erm(C) and erm(A). |
Clinical Trial Drug(s)
1 drug(s) in total
Pristinamycin IA
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Staphylococcus sciuri infection | [1] | |||
Resistant Disease | Staphylococcus sciuri infection [ICD-11: 1B54.1] | |||
Resistant Drug | Pristinamycin IA | |||
Molecule Alteration | Expression | Gene recombination |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus sciuri plasmid pSCFS1 | 1296 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Staphylococcus sciuri Gene erm(33), Encoding Inducible Resistance to Macrolides, Lincosamides, and Streptogramin B Antibiotics, Is a Product of Recombination between erm(C) and erm(A). |
Investigative Drug(s)
1 drug(s) in total
Lincosamides
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Staphylococcus sciuri infection | [1] | |||
Resistant Disease | Staphylococcus sciuri infection [ICD-11: 1B54.1] | |||
Resistant Drug | Lincosamides | |||
Molecule Alteration | Expression | Gene recombination |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus sciuri plasmid pSCFS1 | 1296 | ||
Experiment for Molecule Alteration |
Sequence analysis | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | Staphylococcus sciuri Gene erm(33), Encoding Inducible Resistance to Macrolides, Lincosamides, and Streptogramin B Antibiotics, Is a Product of Recombination between erm(C) and erm(A). |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.