General Information of the Molecule (ID: Mol00959)
Name
Erythromycin resistance protein (ERM33) ,Staphylococcus sciuri
Synonyms
Macrolide-lincosamide-streptogramin B resistance protein; rRNA adenine N-6-methyltransferase; erm33
    Click to Show/Hide
Molecule Type
Protein
Gene Name
erm(33)
Sequence
MNKKNIKDSQNFITSKRNIDKIMTNISLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYNIFGNIPYNISTDIVKRITFESQA
KYSYLIVEKGFAKRLQNLQRALGLLLMVEMDIKMLKKVPPLYFHPKPSVDSVLIVLERHQ
PLISKKDYKKYRSFVYKWVNREYRVLFTKNQFRQALKHANVTNINKLSKEQFLSIFNSYK
LFH
    Click to Show/Hide
Function
This protein produces a dimethylation of the adenine residue at position 2085 in 23S rRNA, resulting in reduced affinity between ribosomes and macrolide-lincosamide-streptogramin B antibiotics.
    Click to Show/Hide
Uniprot ID
Q8KLN5_MAMSC
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Mammaliicoccus
Species: Mammaliicoccus sciuri
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Macrolides
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Staphylococcus sciuri infection [1]
Resistant Disease Staphylococcus sciuri infection [ICD-11: 1B54.1]
Resistant Drug Macrolides
Molecule Alteration Expression
Gene recombination
Experimental Note Identified from the Human Clinical Data
In Vitro Model Staphylococcus sciuri plasmid pSCFS1 1296
Experiment for
Molecule Alteration
Sequence analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Staphylococcus sciuri Gene erm(33), Encoding Inducible Resistance to Macrolides, Lincosamides, and Streptogramin B Antibiotics, Is a Product of Recombination between erm(C) and erm(A).
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Pristinamycin IA
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Staphylococcus sciuri infection [1]
Resistant Disease Staphylococcus sciuri infection [ICD-11: 1B54.1]
Resistant Drug Pristinamycin IA
Molecule Alteration Expression
Gene recombination
Experimental Note Identified from the Human Clinical Data
In Vitro Model Staphylococcus sciuri plasmid pSCFS1 1296
Experiment for
Molecule Alteration
Sequence analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Staphylococcus sciuri Gene erm(33), Encoding Inducible Resistance to Macrolides, Lincosamides, and Streptogramin B Antibiotics, Is a Product of Recombination between erm(C) and erm(A).
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Lincosamides
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Staphylococcus sciuri infection [1]
Resistant Disease Staphylococcus sciuri infection [ICD-11: 1B54.1]
Resistant Drug Lincosamides
Molecule Alteration Expression
Gene recombination
Experimental Note Identified from the Human Clinical Data
In Vitro Model Staphylococcus sciuri plasmid pSCFS1 1296
Experiment for
Molecule Alteration
Sequence analysis
Experiment for
Drug Resistance
MIC assay
Mechanism Description Staphylococcus sciuri Gene erm(33), Encoding Inducible Resistance to Macrolides, Lincosamides, and Streptogramin B Antibiotics, Is a Product of Recombination between erm(C) and erm(A).
References
Ref 1 Staphylococcus sciuri gene erm(33), encoding inducible resistance to macrolides, lincosamides, and streptogramin B antibiotics, is a product of recombination between erm(C) and erm(A). Antimicrob Agents Chemother. 2002 Nov;46(11):3621-3. doi: 10.1128/AAC.46.11.3621-3623.2002.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.