Molecule Information

General Information of the Molecule (ID: Mol00917)
Name
DNA gyrase subunit A (GYRA) ,Escherichia coli
Synonyms
hisW; nalA; parD; b2231; JW2225
    Click to Show/Hide
Molecule Type
Protein
Gene Name
gyrA
Gene ID
66673880
Sequence
MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN
KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM
RYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMAT
NIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDG
MRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRRE
VVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNV
AAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEITANSADINLEDLITQEDVV
VTLSHQGYVKYQPLSEYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRVY
SMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEFEEGVKVFMATANGTVKKTVL
TEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSVRAMGCNTTG
VRGIRLGEGDKVVSLIVPRGDGAILTATQNGYGKRTAVAEYPTKSRATKGVISIKVTERN
GLVVGAVQVDDCDQIMMITDAGTLVRTRVSEISIVGRNTQGVILIRTAEDENVVGLQRVA
EPVDEEDLDTIDGSAAEGDDEIAPEVDVDDEPEEE
    Click to Show/Hide
Function
A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to maintain chromosomes in an underwound state. This makes better substrates for topoisomerase IV (ParC and ParE) which is the main enzyme that unlinks newly replicated chromosomes in E.coli. Gyrase catalyzes the interconversion of other topological isomers of dsDNA rings, including catenanes. Relaxes negatively supercoiled DNA in an ATP-independent manner. E.coli gyrase has higher supercoiling activity than many other bacterial gyrases; at comparable concentrations E.coli gyrase introduces more supercoils faster than M.tuberculosis gyrase, while M.tuberculosis gyrase has higher decatenation than supercoiling activity compared to E.coli. E.coli makes 15% more negative supercoils in pBR322 plasmid DNA than S.typhimurium; the S.typhimurium GyrB subunit is toxic in E.coli, while the E.coli copy can be expressed in S.typhimurium even though the 2 subunits have 777/804 residues identical. The enzymatic differences between E.coli gyrase and topoisomerase IV are largely due to the GyrA C-terminal domain (approximately residues 524-841) and specifically the GyrA-box.
    Click to Show/Hide
Uniprot ID
GYRA_ECOLI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
  EADR: Epigenetic Alteration of DNA, RNA or Protein
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.S83L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-112 562
Escherichia coli strain N-118 562
Escherichia coli strain N-119 562
Escherichia coli strain N-51 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.S83W
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-18 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.D87N
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-113 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.G81C
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-97 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.A84P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-5 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.A67S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-10 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ciprofloxacin XR
 Drug Info 
Molecule Alteration Missense mutation
p.Q106H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-89 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Enoxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Epigenetic Alteration of DNA, RNA or Protein (EADR) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.S83L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-112 562
Escherichia coli strain N-118 562
Escherichia coli strain N-119 562
Escherichia coli strain N-51 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.S83W
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-18 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.D87N
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-113 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.G81C
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-97 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.A84P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-5 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.A67S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-10 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Enoxacin
 Drug Info 
Molecule Alteration Missense mutation
p.Q106H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-89 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Nalidixic acid
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Epigenetic Alteration of DNA, RNA or Protein (EADR) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.S83L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-112 562
Escherichia coli strain N-118 562
Escherichia coli strain N-119 562
Escherichia coli strain N-51 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.S83W
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-18 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.D87N
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-113 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.G81C
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-97 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.A84P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-5 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.A67S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-10 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Nalidixic acid
 Drug Info 
Molecule Alteration Missense mutation
p.Q106H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-89 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.S83L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-112 562
Escherichia coli strain N-118 562
Escherichia coli strain N-119 562
Escherichia coli strain N-51 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.S83W
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-18 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.D87N
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-113 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.G81C
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-97 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.A84P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-5 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.A67S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-10 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Norfloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.Q106H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-89 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Ofloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.S83L
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-112 562
Escherichia coli strain N-118 562
Escherichia coli strain N-119 562
Escherichia coli strain N-51 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.S83W
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-18 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.D87N
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-113 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.G81C
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-97 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.A84P
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-5 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.A67S
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain P-10 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
Disease Class: Bacterial infection [1], [2], [3]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Missense mutation
p.Q106H
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli strain kL16 1425342
Escherichia coli strain N-89 562
Experiment for
Molecule Alteration		 Whole genome sequence assay
Mechanism Description Quinolones are considered to exert antibacterial activity by inhibiting DNA gyrase (EC 5.99.1.3), which catalyzes topological changes of DNA.DNA gyrase of Escherichia coli consists of subunits A and B, which are the products of the gyrA and gyrB genes, respectively. Mutations in either gene can cause quinolone resistance.
References
Ref 1 4-Quinolone resistance mutations in the DNA gyrase of Escherichia coli clinical isolates identified by using the polymerase chain reaction. Antimicrob Agents Chemother. 1991 Feb;35(2):387-9. doi: 10.1128/AAC.35.2.387.
Ref 2 Quinolone resistance-determining region in the DNA gyrase gyrA gene of Escherichia coli. Antimicrob Agents Chemother. 1990 Jun;34(6):1271-2. doi: 10.1128/AAC.34.6.1271.
Ref 3 Cloning and characterization of a DNA gyrase A gene from Escherichia coli that confers clinical resistance to 4-quinolones. Antimicrob Agents Chemother. 1989 Jun;33(6):886-94. doi: 10.1128/AAC.33.6.886.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.