General Information of the Molecule (ID: Mol00857)
Name
CATB10-Ib variant (CATB10) ,Pseudomonas aeruginosa
Synonyms
catB10; CatB10
    Click to Show/Hide
Molecule Type
Protein
Gene Name
catB10
Sequence
MTNYFESPFKGKLLADQVKNPNIKVGRYSYYSGYYHGHSFDECARFLLPDRNDIDQLIVG
SFCSIGTGASFIMAGNQGHRYDWASSFPFFYMKEEPAFSGALDAFQKAGDTVIGSDVWIG
SEAMIMPGINVGHGAVIGSRALVTKDVEPYTIVGGNPAKPIKKRFSDEEIAMLLKMNWWD
WPTEKIEEAMPLLCSSNIVGLHRYWQGFAV
    Click to Show/Hide
Uniprot ID
B8Y897_PSEAI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ceftazidime
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ceftazidime
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa TS-103 287
Pseudomonas aeruginosa TS-832035 287
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description P. aeruginosa TS-832035 produces a carbapenemase, coded by a blaVIM-1 determinant carried by the chromosomal class 1 integron In70.2 (containing also the aacA4, aphA15, and aadA1 genes in its cassette array),which induce the resistance to carbapenems.
Meropenem
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Meropenem
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa TS-103 287
Pseudomonas aeruginosa TS-832035 287
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description P. aeruginosa TS-832035 produces a carbapenemase, coded by a blaVIM-1 determinant carried by the chromosomal class 1 integron In70.2 (containing also the aacA4, aphA15, and aadA1 genes in its cassette array),which induce the resistance to carbapenems.
Imipenem
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Imipenem
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa TS-103 287
Pseudomonas aeruginosa TS-832035 287
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description P. aeruginosa TS-832035 produces a carbapenemase, coded by a blaVIM-1 determinant carried by the chromosomal class 1 integron In70.2 (containing also the aacA4, aphA15, and aadA1 genes in its cassette array),which induce the resistance to carbapenems.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ceftazidime/Cloxacillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Ceftazidime/Cloxacillin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Pseudomonas aeruginosa TS-103 287
Pseudomonas aeruginosa TS-832035 287
Experiment for
Molecule Alteration
Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance
Agar dilution method assay
Mechanism Description P. aeruginosa TS-832035 produces a carbapenemase, coded by a blaVIM-1 determinant carried by the chromosomal class 1 integron In70.2 (containing also the aacA4, aphA15, and aadA1 genes in its cassette array),which induce the resistance to carbapenems.
References
Ref 1 Metallo-Beta-lactamase expression confers an advantage to Pseudomonas aeruginosa isolates compared with other Beta-lactam resistance mechanisms, favoring the prevalence of metallo-Beta-lactamase producers in a clinical environment. Microb Drug Resist. 2010 Sep;16(3):223-30. doi: 10.1089/mdr.2010.0016.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.