Molecule Information

General Information of the Molecule (ID: Mol00835)

Name	Beta-lactamase (BLA) ,Escherichia coli
Synonyms	blaNDM-5; blaNDM; C5N07_29035; CWS33_26475; D0X26_01580; D0X26_30180; EI021_24930; EIZ93_26035; EYV17_23675; EYV18_23855; G5632_22505; pEC1929_0014; TUM18780_51250; Beta-lactamase II; Class B carbapenemase NDM-5; Class B metallo-beta-lactamase NDM-5; Metallo-beta-lactamase NDM-5; NDM-5; NDM-5 metallo-beta-lactamase; New Delhi Metallo carbapenemase protein; New Delhi metallo beta lactamase 5; Subclass B1 metallo-beta-lactamase NDM-5 Click to Show/Hide
Molecule Type	Protein
Gene Name	blaNDM-5
Gene ID	39459987
Sequence	MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ HTSYLDMPGFGAVASNGLIVRDGGRVLLVDTAWTDDQTAQILNWIKQEINLPVALAVVTH AHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPL KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF PKASMIVMSHSAPDSRAAITHTARMADKLR Click to Show/Hide
Uniprot ID	G3K399_ECOLX
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cefoxitin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Cefoxitin		Drug Info
Molecule Alteration	Missense mutation	p.V88L+p.M154L
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Escherichia coli ST648		562
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.

Ceftazidime

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Ceftazidime		Drug Info
Molecule Alteration	Missense mutation	p.V88L+p.M154L
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Escherichia coli ST648		562
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.

Ertapenem

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Ertapenem		Drug Info
Molecule Alteration	Missense mutation	p.V88L+p.M154L
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Escherichia coli ST648		562
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.

Investigative Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Piperacillin/Tazobactam

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Piperacillin/Tazobactam		Drug Info
Molecule Alteration	Missense mutation	p.V88L+p.M154L
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Escherichia coli ST648		562
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	NDM-5 differed from existing enzymes due to substitutions at positions 88 (Val - Leu) and 154 (Met - Leu) and reduced the susceptibility of Escherichia coli TOP10 transformants to expanded-spectrum cephalosporins and carbapenems when expressed under its native promoter.

References

Ref 1	A novel variant, NDM-5, of the New Delhi metallo-Beta-lactamase in a multidrug-resistant Escherichia coli ST648 isolate recovered from a patient in the United Kingdom. Antimicrob Agents Chemother. 2011 Dec;55(12):5952-4. doi: 10.1128/AAC.05108-11. Epub 2011 Sep 19.