Molecule Information

General Information of the Molecule (ID: Mol00816)

• Name: Bcr/CflA family efflux transporter (BCML) ,Salmonella(Salmonella choleraesuis)
• Synonyms: SCH_052
• Molecule Type: Protein
• Gene Name: cmlA
• Sequence:
  MSSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALGTTASTIQLTLTTYLV
  MIGAGQLLFGPLSDRLGRRPVLLGGGLAYVVASMGLALTSSAEVFLGLRILQACGASACL
  VSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVDMWLGWRAIFAFLGLGMI
  AASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLM
  MGRQGVSQLGFSLLFATVAIAMVFTARFMGRVIPKWGSPSVLRMGMGCLIAGAVLLAITE
  IWALQSVLGFIAPMWLVGIGVATAVSVAPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
  LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPNR
• Uniprot ID: Q5J429_SALCH

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Salmonella enterica infection [1]

• Resistant Disease: Salmonella enterica infection [ICD-11: 1A09.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Salmonella enterica serotype Typhimurium SS034; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 1358; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 2039; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 2152; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 2668; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 2855; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 3430; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 3977; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 4204; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 4255; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 4287; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 4501; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 4528; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 4656; 90371
• In Vitro Model: Salmonella enterica serotype Typhimurium 922; 90371
• Experiment for Molecule Alteration: Southern blot hybridizations assay
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: Isolates 2039 and 2152 also carried an additional integron (In-t4) that encodes the cmlA and aadB gene cassettes, which confer resistance to chloramphenicol and kanamycin, respectively.

References

• Ref 1: Characterization of plasmids carrying CMY-2 from expanded-spectrum cephalosporin-resistant Salmonella strains isolated in the United States between 1996 and 1998. Antimicrob Agents Chemother. 2002 May;46(5):1269-72. doi: 10.1128/AAC.46.5.1269-1272.2002.