Molecule Information

General Information of the Molecule (ID: Mol00807)

• Name: ATP-binding cassette transporter A (ABCA) ,Staphylococcus aureus
• Synonyms: abcA; AbcA
• Molecule Type: Protein
• Gene Name: abcA
• Sequence:
  MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRIVDKFSVSHINWNLIA
  LFGGIFVINALLSGLGLYLLSKIGEKIIYRIRSVLWEHIIQLKMPFFDKNESGQLMSRLT
  DDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTFITIPIFVLIMIPLGRIM
  QKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAHKNLNEIYKLGLKQAKIAA
  VVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFYVIQLSMPLINLSTLVTDYK
  KAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEHVDFKYDVKKILDDVSFQIPQ
  GQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESVYDIPLSKWRRKIGYVMQSNSM
  MSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQFDEGYDTLVGERGLKLSGGQRQR
  IDIARSFVKNPDILLLDEATANLDSESELKIQEALETLMEGRTTIVIRDRLSTLKKPVKL
  CGLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD
• Function: May be involved in multidrug export. Transmembrane domains (TMD) form a pore in the cell membrane and the ATP-binding domain (NBD) is responsible for energy generation.
• Uniprot ID: Q53614_STAAU

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Staphylococcus
Species: Staphylococcus aureus

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Daptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Daptomycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Staphylococcus aureus MW2; 1242971
• In Vivo Model: Swiss webster male mice model; Mus musculus
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.

Disease Class: Bacteremia [1], [2], [3]

• Resistant Disease: Bacteremia [ICD-11: MA15.0]
• Resistant Drug: Daptomycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Staphylococcus aureus MW2; 1242971
• In Vivo Model: Swiss webster male mice model; Mus musculus
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.

Investigative Drug(s) 1 drug(s) in total

Moenomycin A

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1], [2], [3]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Moenomycin A
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Staphylococcus aureus MW2; 1242971
• In Vivo Model: Swiss webster male mice model; Mus musculus
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.

Disease Class: Bacteremia [1], [2], [3]

• Resistant Disease: Bacteremia [ICD-11: MA15.0]
• Resistant Drug: Moenomycin A
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli TOP10; 83333
• In Vitro Model: Staphylococcus aureus MW2; 1242971
• In Vivo Model: Swiss webster male mice model; Mus musculus
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The ATP-dependent transporter gene abcA in Staphylococcus aureus confers resistance to hydrophobic Beta-lactams.

References

• Ref 1: Regulation of antibiotic resistance in Staphylococcus aureus. Int J Med Microbiol. 2010 Feb;300(2-3):118-29. doi: 10.1016/j.ijmm.2009.08.015. Epub 2009 Oct 2.
• Ref 2: Regulation of expression of abcA and its response to environmental conditions. J Bacteriol. 2014 Apr;196(8):1532-9. doi: 10.1128/JB.01406-13. Epub 2014 Feb 7.
• Ref 3: Multidrug-Resistance Transporter AbcA Secretes Staphylococcus aureus Cytolytic Toxins. J Infect Dis. 2016 Jan 15;213(2):295-304. doi: 10.1093/infdis/jiv376. Epub 2015 Jul 9.