Molecule Information

General Information of the Molecule (ID: Mol00798)

Name	Aminoglycoside N(3)-acetyltransferase III (A3AC3) ,Serratia marcescens
Synonyms	ACC(3)-III; Aminocyclitol 3-N-acetyltransferase type III; Gentamicin-(3)-N-acetyl-transferase Click to Show/Hide
Molecule Type	Protein
Gene Name	aac3-Vb
Sequence	MNTIESITADLHGLGVRPGDLIMVHASLKAVGPVEGGAASVVSALRAAVGSAGTLMGYAS WDRSPYEETLNGARMDEELRRRWPPFDLATSGTYPGFGLLNRFLLEAPDARRSAHPDASM VAVGPLAATLTEPHRLGQALGEGSPLERFVGHGGKVLLLGAPLDSVTVLHYAEAIAPIPN KRRVTYEMPMLGPDGRVRWELAEDFDSNGILDCFAVDGKPDAVETIAKAYVELGRHREGI VGRAPSYLFEAQDIVSFGVTYLEQHFGAP Click to Show/Hide
Function	Resistance to antibiotics containing the 2-deoxy-streptamine ring including gentamicin, kanamycin, tobramycin, neomycin and apramycin. Click to Show/Hide
Uniprot ID	AAC3_SERMA
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Nocardiaceae Genus: Nocardia Species: Nocardia otitidiscaviarum

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Amikacin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Amikacin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli strain DH5a		668369
	Serratia marcescens strain 82041944		615
Experiment for Drug Resistance	Broth microdilution method assay
Mechanism Description	The AAC(3)-V resistance mechanism is characterized by high-level resistance to the aminoglycosides gentamicin, netilmicin, 2'-N-ethylnetilmicin, and 6'-N-ethylnetilmicin and moderate resistance levels to tobramycin.

Gentamicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Gentamicin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli strain DH5a		668369
	Serratia marcescens strain 82041944		615
Experiment for Drug Resistance	Broth microdilution method assay
Mechanism Description	The AAC(3)-V resistance mechanism is characterized by high-level resistance to the aminoglycosides gentamicin, netilmicin, 2'-N-ethylnetilmicin, and 6'-N-ethylnetilmicin and moderate resistance levels to tobramycin.

References

Ref 1	Cloning and DNA sequence analysis of an aac(3)-Vb gene from Serratia marcescens. Antimicrob Agents Chemother. 1992 Oct;36(10):2222-7. doi: 10.1128/AAC.36.10.2222.
Ref 2	Molecular genetics of aminoglycoside resistance genes and familial relationships of the aminoglycoside-modifying enzymes. Microbiol Rev. 1993 Mar;57(1):138-63. doi: 10.1128/mr.57.1.138-163.1993.