Molecule Information

General Information of the Molecule (ID: Mol00793)

Name	Aminoglycoside adenyltransferase 2''-Ia (ANT2I) ,Klebsiella pneumoniae
Synonyms	AAD(2''); Aminoglycoside adenyltransferase 2''-Ia; ANT(2'')-Ia; Gentamicin 2''-nucleotidyltransferase; Gentamicin resistance protein Click to Show/Hide
Molecule Type	Protein
Gene Name	aadB
Gene ID	67369350
Sequence	MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAI VEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPV RCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA Click to Show/Hide
Function	Mediates bacterial resistance to kanamycin, gentamicin, dibekacin, sisomicin and tobramycin by adenylating the 2''-hydroxyl group of these antibiotics. Click to Show/Hide
Uniprot ID	AADB1_KLEPN
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Klebsiella Species: Klebsiella pneumoniae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Gentamicin B

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Gentamicin B		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Acinetobacter baumannii AB5075		1116234
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.

Gentamicin C

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Gentamicin C		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Acinetobacter baumannii AB5075		1116234
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.

Tobramycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Tobramycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Acinetobacter baumannii AB5075		1116234
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	ANT(2")-Ia confers resistance by magnesium-dependent transfer of a nucleoside monophosphate (AMP) to the 2"-hydroxyl of aminoglycoside substrates containing a 2-deoxystreptamine core.

References

Ref 1	Structural and molecular basis for resistance to aminoglycoside antibiotics by the adenylyltransferase ANT(2")-Ia. mBio. 2015 Jan 6;6(1):e02180-14. doi: 10.1128/mBio.02180-14.
Ref 2	Nucleotide sequence of the AAD(2'') aminoglycoside adenylyltransferase determinant aadB. Evolutionary relationship of this region with those surrounding aadA in R538-1 and dhfrII in R388. Nucleic Acids Res. 1986 Nov 11;14(21):8625-35. doi: 10.1093/nar/14.21.8625.