Molecule Information

General Information of the Molecule (ID: Mol00774)

Name	Aminoglycoside (3'') (9) adenylyltransferase (AADA) ,Escherichia coli
Synonyms	aadA; aadA1b; aadA1d; aadA2; aadAI; BO068_004688; BO068_005462; BON66_04400; BON68_01140; BON70_24900; BON72_22960; BON94_27315; BTQ06_25060; CQP61_00015; DAH50_23555; DKP82_26115; GF147_27240; GF147_27245; GQW07_24995; GQW07_26760; GQW07_26780; GRO95_25260; GRO95_26815; GRO95_26835; pO103_87 Click to Show/Hide
Molecule Type	Protein
Gene Name	aadA1
Sequence	MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDE TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA GDERNVVLTLSRIWYSAVTGRIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA SRADQLEEFVHYVKGEITKVVGK Click to Show/Hide
Uniprot ID	Q79JG0_ECOLX
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

5 drug(s) in total

Click to Show/Hide the Full List of Drugs

Ampicillin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Urinary tract infection			[1]
Resistant Disease	Urinary tract infection [ICD-11: GC08.1]		Disease Info
Resistant Drug	Ampicillin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli serogroup O11		1095705
	Escherichia coli serogroup O17		1010800
	Escherichia coli serogroup O73		2170725
	Escherichia coli serogroup O77		562
Experiment for Molecule Alteration	PCR amplification and sequence alignments assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Ciprofloxacin XR

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Urinary tract infection			[1]
Resistant Disease	Urinary tract infection [ICD-11: GC08.1]		Disease Info
Resistant Drug	Ciprofloxacin XR		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli serogroup O11		1095705
	Escherichia coli serogroup O17		1010800
	Escherichia coli serogroup O73		2170725
	Escherichia coli serogroup O77		562
Experiment for Molecule Alteration	PCR amplification and sequence alignments assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Co-trimoxazole

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Urinary tract infection			[1]
Resistant Disease	Urinary tract infection [ICD-11: GC08.1]		Disease Info
Resistant Drug	Co-trimoxazole		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli serogroup O11		1095705
	Escherichia coli serogroup O17		1010800
	Escherichia coli serogroup O73		2170725
	Escherichia coli serogroup O77		562
Experiment for Molecule Alteration	PCR amplification and sequence alignments assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Gentamicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Urinary tract infection			[1]
Resistant Disease	Urinary tract infection [ICD-11: GC08.1]		Disease Info
Resistant Drug	Gentamicin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli serogroup O11		1095705
	Escherichia coli serogroup O17		1010800
	Escherichia coli serogroup O73		2170725
	Escherichia coli serogroup O77		562
Experiment for Molecule Alteration	PCR amplification and sequence alignments assay
Experiment for Drug Resistance	Microdilution method assay
Mechanism Description	All the UTI outbreak CgA strains in this study contained the same class 1 integron dfrA17-aadA5 gene cassette arrangement with 100% sequence match, suggesting clonal spread of the bacterial strain itself. While aminoglycoside adenyltransferase A (aadA ) and dihydrofolate reductase A (dfrA ), encoding resistance to streptomycin and trimethoprim.

Streptomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Escherichia coli infection			[2]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Streptomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli Co227		562
	Escherichia coli Co228		562
	Escherichia coli Co232		562
	Escherichia coli Co354		562
Experiment for Molecule Alteration	PCR; PCR-restriction fragment length polymorphism analysis; Sequencing assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	Multiple-antibiotic-resistant phenotype is associated with gene mutation and mar locus regulation.

References

Ref 1	Global spread of mobile antimicrobial drug resistance determinants in human and animal Escherichia coli and Salmonella strains causing community-acquired infections. Clin Infect Dis. 2009 Aug 1;49(3):365-71. doi: 10.1086/600301.
Ref 2	Mechanisms of resistance in multiple-antibiotic-resistant Escherichia coli strains of human, animal, and food origins. Antimicrob Agents Chemother. 2004 Oct;48(10):3996-4001. doi: 10.1128/AAC.48.10.3996-4001.2004.