Molecule Information

General Information of the Molecule (ID: Mol04432)

• Name: Acidic leucine-rich nuclear phosphoprotein 32 family member E (ANP32E) ,Homo sapiens
• Synonyms: LANP-like protein
• Molecule Type: Protein
• Gene Name: ANP32E
• Gene ID: 81611
• Sequence:
  MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL
  PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLD
  L FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEA
  GP PEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVE
  EGE EEEEEEEGGLRGEKRKRDAEDDGEEEDD
• Function: Histone chaperone that specifically mediates the genome-wideremoval of histone H2A.Z/H2AZ1 from the nucleosome: removes H2A.Z/H2AZ1from its normal sites of deposition, especially from enhancer andinsulator regions. Not involved in deposition of H2A.Z/H2AZ1 in thenucleosome. May stabilize the evicted H2A.Z/H2AZ1-H2B dimer, thusshifting the equilibrium towards dissociation and the off-chromatinstate . Inhibits activity of protein phosphatase 2A. Does not inhibit protein phosphatase 1. May play a role incerebellar development and synaptogenesis.{ECO:0000269|PubMed:24463511}.
• Uniprot ID: AN32E_HUMAN
• Ensembl ID: ENSG0000014340115
• HGNC ID: HGNC:16673

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Paclitaxel

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Sensitive Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Sensitive Drug: Paclitaxel
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Ferroptosis signaling pathway; Activation; hsa04216
• In Vitro Model: KYSE150 cells; Esophagus; Homo sapiens (Human); CVCL_1348
• Experiment for Molecule Alteration: Western blot assay
• Experiment for Drug Resistance: CCK8 assay; Colony formation assay
• Mechanism Description: Repression of ANP32E increases the responsiveness of EC to PTX, and the concurrent use of erastin with PTX enhances their anti-cancer effectiveness. These findings provide support for the efficacy of inducing ferroptosis as a potential therapeutic approach to enhance the cytotoxic effects of PTX. ANP32E regulates EC progression and ferroptosis through the p53/SLC7A11 axis, offering a potential molecular target for overcoming PTX resistance in EC treatment.

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Sensitive Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Sensitive Drug: Paclitaxel
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Ferroptosis signaling pathway; Activation; hsa04216
• In Vitro Model: KYSE-30 cells; Esophagus; Homo sapiens (Human); CVCL_1351
• Experiment for Molecule Alteration: Western blot assay
• Experiment for Drug Resistance: CCK8 assay; Colony formation assay
• Mechanism Description: Repression of ANP32E increases the responsiveness of EC to PTX, and the concurrent use of erastin with PTX enhances their anti-cancer effectiveness. These findings provide support for the efficacy of inducing ferroptosis as a potential therapeutic approach to enhance the cytotoxic effects of PTX. ANP32E regulates EC progression and ferroptosis through the p53/SLC7A11 axis, offering a potential molecular target for overcoming PTX resistance in EC treatment.

Patented Agent(s) 1 drug(s) in total

Erastin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Sensitive Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Sensitive Drug: Erastin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Ferroptosis signaling pathway; Activation; hsa04216
• In Vitro Model: KYSE150 cells; Esophagus; Homo sapiens (Human); CVCL_1348
• In Vitro Model: KYSE-30 cells; Esophagus; Homo sapiens (Human); CVCL_1351
• Experiment for Molecule Alteration: Western blot assay
• Experiment for Drug Resistance: CCK8 assay; Colony formation assay
• Mechanism Description: Repression of ANP32E increases the responsiveness of EC to PTX, and the concurrent use of erastin with PTX enhances their anti-cancer effectiveness. These findings provide support for the efficacy of inducing ferroptosis as a potential therapeutic approach to enhance the cytotoxic effects of PTX. ANP32E regulates EC progression and ferroptosis through the p53/SLC7A11 axis, offering a potential molecular target for overcoming PTX resistance in EC treatment.

References

• Ref 1: ANP32E promotes esophageal cancer progression and paclitaxel resistance via P53/SLC7A11 axis-regulated ferroptosis. Int Immunopharmacol. 2025 Jan 10;144:113436.