Molecule Information

General Information of the Molecule (ID: Mol04431)

Name	Thioredoxin domain-containing protein 17 (TXNDC17) ,Homo sapiens
Synonyms	14 kDa thioredoxin-related protein; Protein 42-9-9; Thioredoxin-like protein 5 Click to Show/Hide
Molecule Type	Protein
Gene Name	TXNDC17
Gene ID	84817
Sequence	MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEML F SED Click to Show/Hide
Function	Disulfide reductase. May participate in various redoxreactions through the reversible oxidation of its active center dithiolto a disulfide and catalyze dithiol-disulfide exchange reactions.Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidaseactivity and may contribute to the elimination of cellular hydrogenperoxide. {ECO:0000269\|PubMed:14607843, ECO:0000269\|PubMed:14607844}. Click to Show/Hide
Uniprot ID	TXD17_HUMAN
Ensembl ID	ENSG0000012923511
HGNC ID	HGNC:28218
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Glioma [ICD-11: 2A00.1]				[1]
Resistant Disease	Glioma [ICD-11: 2A00.1]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		.
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell autophagy		Inhibition	hsa04140
In Vitro Model	SH-SY5Y cells	Abdomen	Homo sapiens (Human)	CVCL_0019
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The overexpression of BECN1 and TXNDC17 reduced NB sensitivity to cisplatin (DDP), etoposide (VP16), and cyclophosphamide (CTX). Autophagy mediated by BECN1 was regulated by TXNDC17, and this process was involved in the resistance to DDP, VP16, and CTX in NB. Suberoylanilide hydroxamic acid (SAHA) can enhance the sensitivity and apoptosis of NB cells to chemotherapeutics by inhibiting TXNDC17, ultimately decreasing autophagy-mediated chemoresistance.

Cyclophosphamide

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Glioma [ICD-11: 2A00.1]				[1]
Resistant Disease	Glioma [ICD-11: 2A00.1]			Disease Info
Resistant Drug	Cyclophosphamide			Drug Info
Molecule Alteration	Expression		.
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell autophagy		Inhibition	hsa04140
In Vitro Model	SH-SY5Y cells	Abdomen	Homo sapiens (Human)	CVCL_0019
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The overexpression of BECN1 and TXNDC17 reduced NB sensitivity to cisplatin (DDP), etoposide (VP16), and cyclophosphamide (CTX). Autophagy mediated by BECN1 was regulated by TXNDC17, and this process was involved in the resistance to DDP, VP16, and CTX in NB. Suberoylanilide hydroxamic acid (SAHA) can enhance the sensitivity and apoptosis of NB cells to chemotherapeutics by inhibiting TXNDC17, ultimately decreasing autophagy-mediated chemoresistance.

Etoposide

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Glioma [ICD-11: 2A00.1]				[1]
Resistant Disease	Glioma [ICD-11: 2A00.1]			Disease Info
Resistant Drug	Etoposide			Drug Info
Molecule Alteration	Expression		.
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell autophagy		Inhibition	hsa04140
In Vitro Model	SH-SY5Y cells	Abdomen	Homo sapiens (Human)	CVCL_0019
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The overexpression of BECN1 and TXNDC17 reduced NB sensitivity to cisplatin (DDP), etoposide (VP16), and cyclophosphamide (CTX). Autophagy mediated by BECN1 was regulated by TXNDC17, and this process was involved in the resistance to DDP, VP16, and CTX in NB. Suberoylanilide hydroxamic acid (SAHA) can enhance the sensitivity and apoptosis of NB cells to chemotherapeutics by inhibiting TXNDC17, ultimately decreasing autophagy-mediated chemoresistance.

References

Ref 1	Mechanism of Drug Resistance to First-Line Chemotherapeutics Mediated by TXNDC17 in Neuroblastomas. Cancer Rep (Hoboken). 2024 Oct;7(10):e70033.