Molecule Information

General Information of the Molecule (ID: Mol04418)

• Name: Membrane-associated protein TcaA (tcaA) ,Homo sapiens
• Molecule Type: Protein
• Gene Name: tcaA
• Sequence:
  MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFIL
  ILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIK
  D EVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAP
  TK QPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFILGTYRIPAMKSTENGDFAGY
  LKF DFRQSNSETVDVTEDFEEANITVTLKGDTKLNDSSKKVTINDREMAFSSSKTYGPY
  PQNK DITISASGKAKGKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENS
  LKNKL IEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQI
  IDAEKH GDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK
• Function: Plays a major role in decreasing resistance to glycopeptideantibiotics. {ECO:0000250}.
• Uniprot ID: TCAA_STAAN

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Oxacillin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]

• Resistant Disease: Staphylococcus aureus infection [ICD-11: 1B54.0]
• Resistant Drug: Oxacillin
• Molecule Alteration: Expression; .
• Experimental Note: Revealed Based on the Cell Line Data
• Experiment for Molecule Alteration: qPCR
• Experiment for Drug Resistance: E-test assay
• Mechanism Description: The MIC of penicillin plus clavulanate decreased from 3 mg/L to 0.064 mg/L and that of oxacillin decreased from 16 to 0.5 mg/L when?tcaA?was knocked out in the LAC strain. Compared with wild-type MRSA isolates, when?tcaA?was deleted, all selected strains were more susceptible to beta-lactams. Susceptibility to ceftobiprole was restored in the ceftobiprole-resistant strain when?tcaA?was deleted.?tcaA?knockout caused "log-like" abnormal division of MRSA, and?tcaA?deficiency mediated low expression of?mecA, ponA, and?murA2. tcaA is a potential resistance breaker target for beta-lactams, including ceftobiprole, in MRSA.

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]

• Sensitive Disease: Staphylococcus aureus infection [ICD-11: 1B54.0]
• Sensitive Drug: Oxacillin
• Molecule Alteration: Expression; .
• Experimental Note: Revealed Based on the Cell Line Data
• Experiment for Molecule Alteration: qPCR
• Experiment for Drug Resistance: E-test assay
• Mechanism Description: The MIC of penicillin plus clavulanate decreased from 3 mg/L to 0.064 mg/L and that of oxacillin decreased from 16 to 0.5 mg/L when?tcaA?was knocked out in the LAC strain. Compared with wild-type MRSA isolates, when?tcaA?was deleted, all selected strains were more susceptible to beta-lactams. Susceptibility to ceftobiprole was restored in the ceftobiprole-resistant strain when?tcaA?was deleted.?tcaA?knockout caused "log-like" abnormal division of MRSA, and?tcaA?deficiency mediated low expression of?mecA, ponA, and?murA2. tcaA is a potential resistance breaker target for beta-lactams, including ceftobiprole, in MRSA.

References

• Ref 1: Role of tcaA, a potential target as a ceftobiprole resistance breaker in MRSA beta-lactam resistance. Int J Antimicrob Agents. 2024 Jul;64(1):107185.