Molecule Information

General Information of the Molecule (ID: Mol04416)

• Name: Calcium/manganese antiporter SLC30A10 (SLC30A10) ,Homo sapiens
• Synonyms: Solute carrier family 30 member 10 ; Zinc transporter 10
• Molecule Type: Protein
• Gene Name: SLC30A10
• Gene ID: 55532
• Sequence:
  MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
  ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIV
  G VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRR
  AA DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALN
  IRG VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAF
  PLIK ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPK
  DRGYQ DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLC
  CPPGAL PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKT
  QEDQCYV NRTHF
• Function: Calcium:manganese antiporter of the plasma membrane mediatingthe efflux of intracellular manganese coupled to an activeextracellular calcium exchange . Required forintracellular manganese homeostasis, an essential cation for thefunction of several enzymes, including some crucially important for themetabolism of neurotransmitters and other neuronal metabolic pathways.Manganese can also be cytotoxic and induce oxidative stress,mitochondrial dysfunction and apoptosis .Could also have an intracellular zinc ion transporter activity,directly regulating intracellular zinc ion homeostasis and moreindirectly various signaling pathway and biological processes. {ECO:0000269|PubMed:22341972,ECO:0000269|PubMed:22427991, ECO:0000269|PubMed:25319704,ECO:0000269|PubMed:26728129, ECO:0000269|PubMed:27226609,ECO:0000269|PubMed:27307044, ECO:0000269|PubMed:30755481}.
• Uniprot ID: ZNT10_HUMAN
• Ensembl ID: ENSG0000019666012
• HGNC ID: HGNC:25355

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: cancer [ICD-11: 2D4Z] [1]

• Resistant Disease: cancer [ICD-11: 2D4Z]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: HCT15 cells; Colon; Homo sapiens (Human); CVCL_0292
• In Vitro Model: HuTu80 cells; Small intestine; Homo sapiens (Human); CVCL_1301
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: The cell growth rate, mitochondrial activity, zinc accumulation, and sensitivity to the drugs cetuximab and cisplatin were investigated in functional tests. Overexpression or depletion of SLC30A or SLC39A family genes resulted in the deep reshaping of intracellular signaling and provoked hyperactivation of mitochondrial respiration. Variation in the expression of the SLC30A/SLC39A genes did not increase the sensitivity to cetuximab but significantly altered the sensitivity to cisplatin: overexpression of?SLC30A10?resulted in an ~2.7-4 times increased IC50 of cisplatin, and overexpression of?SLC30A3?resulted in an ~3.3 times decreased IC50 of cisplatin. The SLC30A/SLC39A genes should be considered as potential cancer drug resistance biomarkers and putative therapeutic targets.

References

• Ref 1: Forced Overexpression and Knockout Analysis of SLC30A and SLC39A Family Genes Suggests Their Involvement in Establishing Resistance to Cisplatin in Human Cancer Cells. Int J Mol Sci. 2024 Nov 9;25(22):12049.