General Information of the Molecule (ID: Mol04411)
Name
Bcl-2 homologous antagonist/killer (BAK1) ,Homo sapiens
Synonyms
Apoptosis regulator BAK; Bcl-2-like protein 7
    Click to Show/Hide
Molecule Type
Protein
Gene Name
BAK1
Gene ID
578
Sequence
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLF
E SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWV
AA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
    Click to Show/Hide
Function
Plays a role in the mitochondrial apoptotic process. Uponarrival of cell death signals, promotes mitochondrial outer membrane permeabilization by oligomerizing to form pores within the MOM.This releases apoptogenic factors into the cytosol, includingcytochrome c, promoting the activation of caspase 9 which in turnprocesses and activates the effector caspases.{ECO:0000269|PubMed:17157251, ECO:0000269|PubMed:8521816}.
    Click to Show/Hide
Uniprot ID
BAK_HUMAN
Ensembl ID
ENSG0000003011014
HGNC ID
HGNC:949
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Venetoclax
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Diffuse large B-cell lymphoma [ICD-11: 2A81.0] [1]
Resistant Disease Diffuse large B-cell lymphoma [ICD-11: 2A81.0]
Resistant Drug Venetoclax
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Apoptosis signaling pathway Inhibition hsa04210
In Vitro Model SU-DHL-2 cells N.A. Homo sapiens (Human) CVCL_9950
SUDHL4 cells Blood Homo sapiens (Human) CVCL_0539
SUDHL5 cells Blood Homo sapiens (Human) CVCL_1735
SUDHL6 cells Blood Homo sapiens (Human) CVCL_2206
SUDHL8 cells Blood Homo sapiens (Human) CVCL_2207
SUDHL10 cells Blood Homo sapiens (Human) CVCL_1889
SUDHL16 cells Blood Homo sapiens (Human) CVCL_1890
Toledo cells Peripheral blood Homo sapiens (Human) CVCL_3611
Experiment for
Molecule Alteration
Western blot assay; RNA Sequencing assay; Flow cytometry
Experiment for
Drug Resistance
Cell survival and synergy assay; Caspase-3/7 apoptosis assay; Live/Dead assay
Mechanism Description Our findings demonstrate that multiple, complex mechanisms of venetoclax resistance can emerge in DLBCL. However, our elucidation of the increased vulnerability of venetoclax-resistant DLBCL to ETC complex I and IDH2 inhibition revealed potential new treatment approaches to overcome venetoclax resistance. Although there is still interest in adding venetoclax to decrease the threshold of apoptosis in the therapeutic armamentarium for DLBCL as a combination therapy, targeting other BCL2 family members, such as BCLW and BFL1, for which there are currently no specific targeted agents, could also be an option.
References
Ref 1 Identifying Targetable Vulnerabilities to Circumvent or Overcome Venetoclax Resistance in Diffuse Large B-Cell Lymphoma. Cancers (Basel). 2024 Jun 3;16(11):2130.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.