Molecule Information
General Information of the Molecule (ID: Mol04405)
| Name |
Transcription factor HES-1 (HES1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Class B basic helix-loop-helix protein 39; Hairy and enhancer of split 1; Hairy homolog; Hairy-like protein
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
HES1
|
||||
| Gene ID | |||||
| Sequence |
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMN E VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQH AP FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGA FAH SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN Click to Show/Hide
|
||||
| Function |
Transcriptional repressor of genes that require a bHLHprotein for their transcription. May act as a negative regulator ofmyogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA onN-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity . May play a role in afunctional FA core complex response to DNA cross-link damage, beingrequired for the stability and nuclear localization of FA core complexproteins, as well as for FANCD2 monoubiquitination in response to DNAdamage. {ECO:0000250, ECO:0000269|PubMed:18550849}.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] | [1] | |||
| Resistant Disease | Breast adenocarcinoma [ICD-11: 2C60.1] | |||
| Resistant Drug | Eribulin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Notch signaling pathway | Activation | hsa04330 | |
| JAK-STAT signaling pathway | Activation | hsa04630 | ||
| In Vitro Model | MCF-7 ER cells | Breast | Homo sapiens (Human) | N.A. |
| Experiment for Molecule Alteration |
Western blot assay | |||
| Experiment for Drug Resistance |
Annexin V/PI assay; MTT assay | |||
| Mechanism Description | We confirmed that BYL-719 could inhibit BCSC-like cell proliferation in 3D cultures and that the stemness characteristics of BCSC-like cells were inhibited. The PI3K/AKT/mTOR signaling pathway could be inhibited by BYL-719, and the Notch, JAK-STAT and MAPK/ERK signaling pathways which have crosstalk in the tumor microenvironment (TME) are also inhibited. By comparing eribulin-resistant breast cancer cell lines, we confirmed that BYL-719 could effectively overcome drug resistance. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
