Molecule Information

General Information of the Molecule (ID: Mol04391)

• Name: CRISPR system Cms protein Csm4 (csm4) ,Homo sapiens
• Synonyms: CRISPR type III-A associated RAMP protein Csm4
• Molecule Type: Protein
• Gene Name: csm4
• Gene ID: 888908
• Sequence:
  MNSRLFRFDFDRTHFGDHGLESSTISCPADTLYSALCVEALRMGGQQLLGELVACSTLRL
  TDLLPYVGPDYLVPKPLHSVRSDGSSMQKKLAKKIGFLPAAQLGSFLDGTADLKELAAR
  Q TKIGVHAVSAKAAIHNGKKDADPYRVGYFRFELDAGLWLLATGSESELGLLTRLLKGI
  SA LGGERTSGFGAFNLTESEAPAALTPTVDAASLMTLTTSLPTDDELEAALAGATYRLV
  KRS GFVASSTYADMPLRKRDIYKFAAGSVFSRPFQGGILDVSLGGNHPVYSYARPLFLA
  LPES AA
• Function: CRISPR is an adaptive immune system that provides protection againstmobile genetic elements . CRISPR clusters contain spacers, sequences complementary toantecedent mobile elements, and target invading nucleic acids. CRISPRclusters are transcribed and processed into CRISPR RNA . Thetype III-A Csm effector complex binds crRNA and acts as a crRNA-guidedRNase, DNase and cyclic oligoadenylate synthase; binding of target RNAcognate to the crRNA is required for all activities . ThisCRISPR-Cas system protects bacteria against transformation withplasmids containing DNA homologous to its spacer regions. {ECO:0000269|PubMed:29979631,ECO:0000305|PubMed:29979631}.; The subunit probably binds to the 5' handle of the crRNA,helping in discrimination between self- and non-self.{ECO:0000250|UniProtKB:A0A0A7HGA1}.
• Uniprot ID: CSM4_MYCTU

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Capreomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Tuberculosis [ICD-11: 1B10.0] [1]

• Resistant Disease: Tuberculosis [ICD-11: 1B10.0]
• Resistant Drug: Capreomycin
• Molecule Alteration: Mutation; K444R/E+N450D
• In Vitro Model: L6TG Cap cells; N.A.; Homo sapiens (Human); CVCL_C566
• Experiment for Drug Resistance: MIC assay; Time-Kill assay
• Mechanism Description: We found that, the?rv2820c?K114N mutation was highly enriched in CAP-resistant?Mtb?clinical isolates, especially in those isolates with the known CAP resistance conferring mutation?rrs?A1401G, implying the association of this mutation with the antimycobacterial efficacy of CAP. Subsequently, over-expressing the?rv2820c?K114N mutant was shown to increase the tolerance to CAP in?Ms, implying that the?rv2820c?K114N mutation might also confer tolerance to CAP in?Mtb?and be considered as a potential molecular marker for CAP tolerance in?Mtb?clinical isolates.

References

• Ref 1: The rv2820c K114N mutation is related with capreomycin tolerance. Tuberculosis (Edinb). 2024 Sep;148:102551.