Molecule Information

General Information of the Molecule (ID: Mol04350)

• Name: Interleukin-10 (IL10) ,Homo sapiens
• Synonyms: Cytokine synthesis inhibitory factor
• Molecule Type: Protein
• Gene Name: IL10
• Gene ID: 3586
• Sequence:
  MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
  LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTL
  R LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Function: Major immune regulatory cytokine that acts on many cells ofthe immune system where it has profound anti-inflammatory functions,limiting excessive tissue disruption caused by inflammation.Mechanistically, IL10 binds to its heterotetrameric receptor comprisingIL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation ofSTAT3 . In turn, STAT3 translocates to the nucleuswhere it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells such asmacrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha . Also interferes with antigenpresentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce Tcell activation . In addition, controls theinflammatory response of macrophages by reprogramming essentialmetabolic pathways including mTOR signaling .{ECO:0000250|UniProtKB:P18893, ECO:0000269|PubMed:11564774,ECO:0000269|PubMed:16982608, ECO:0000269|PubMed:18025162,ECO:0000269|PubMed:1940799, ECO:0000269|PubMed:7512027,ECO:0000269|PubMed:8144879}.
• Uniprot ID: IL10_HUMAN
• Ensembl ID: ENSG000001366347
• HGNC ID: HGNC:5962

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Arsenic trioxide

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Acute promyelocytic leukemia [ICD-11: 2A60.2] [1]

• Resistant Disease: Acute promyelocytic leukemia [ICD-11: 2A60.2]
• Resistant Drug: Arsenic trioxide
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: NB4 cells; Bone marrow; Homo sapiens (Human); CVCL_0005
• Experiment for Molecule Alteration: RT-PCR
• Experiment for Drug Resistance: MTS assay
• Mechanism Description: ATO-resistant APL cells showed upregulation of?APAF1,?BCL2,?BIRC3, and?NOL3?genes, while?CD70?and?IL10?genes were downregulated, compared to ATO-sensitive cells.

References

• Ref 1: Combination Treatment of Resistant Acute Promyelocytic Leukemia Cells with Arsenic Trioxide and Anti-Apoptotic Gene Inhibitors. Pharmaceuticals (Basel). 2024 Nov 14;17(11):1529.