Molecule Information
General Information of the Molecule (ID: Mol04327)
| Name |
SPARC (SPARC)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Basement-membrane protein 40; Osteonectin; Secreted protein acidic and rich in cysteine
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SPARC
|
||||
| Gene ID | |||||
| Sequence |
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTF D SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTL YE RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQ LDQ HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKD IDKD LVI Click to Show/Hide
|
||||
| Function |
Appears to regulate cell growth through interactions with theextracellular matrix and cytokines. Binds calcium and copper, severaltypes of collagen, albumin, thrombospondin, PDGF and cell membranes.There are two calcium binding sites; an acidic domain that binds 5 to 8Ca with a low affinity and an EF-hand loop that binds a Ca ionwith a high affinity.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] | [1] | |||
| Sensitive Disease | Breast adenocarcinoma [ICD-11: 2C60.1] | |||
| Sensitive Drug | Lapatinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vivo Model | Athymic nude mice model | Mus musculus | ||
| Experiment for Molecule Alteration |
CD spectroscopy assay; SDS-PAGE assay | |||
| Experiment for Drug Resistance |
Cell viability assay; Fluorescence microscope assay | |||
| Mechanism Description | HER2-positive breast cancer constitutes 20 % of reported cases, characterized by excessive expression of HER2 receptors, pivotal in cell signaling and growth. Immunotherapy, the established treatment, often leads to multidrug resistance and tumor recurrence. There's a critical need for an effective strategy delaying drug resistance onset and ensuring cancer cell eradication. This study aimed to develop nanoparticles using human serum albumin (HSA) coupled with vitamin E (alpha-tocopherol succinate), loaded with a tyrosine kinase inhibitor (TKI) or aromatase inhibitor (AI). Nanoparticles were formed via desolvation, where HSA(VE) conjugates self-organized into a nanoparticle structure, incorporating TKI/AI either through chemical conjugation or direct binding to HSA. Physico-chemical analyses-such as infrared spectroscopy (IR), gel permeation chromatography (GPC), UV, IR, and CD spectroscopy confirmed HSA(VE) binding and drug incorporation into nanoparticles, evaluating their drug entrapment, release efficiency. Cell viability assays and in-vitro experiments on resistant and sensitive cell lines demonstrated effective drug encapsulation and absorption over time. Both in vitro and in vivo studies demonstrated that a combination of Lapa@HSA(VE) NPs and Let@HSA(VE) NPs in the ratio 75:25 inhibited tumor development and enhanced apoptosis significantly compared to individual NP treatment and free drug. The combination NPs therapy exhibited significant efficacy even in Lapa-resistant cell lines. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
