Molecule Information
General Information of the Molecule (ID: Mol04303)
| Name |
Protein LDOC1 (LDOC1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Leucine zipper protein down-regulated in cancer cells
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
LDOC1
|
||||
| Gene ID | |||||
| Sequence |
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGE
SSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYR A FLDEMKQCFGWDDDEDDDDEEEEDDY Click to Show/Hide
|
||||
| Function |
May have an important role in the development and/orprogression of some cancers.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [1] | |||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | |||
| Sensitive Drug | Calycosin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | LDOC1/GNL3L/NFkappaB signalling pathway | Regulation | N.A. | |
| In Vitro Model | CL1-0 GEMR cells | Lung | Homo sapiens (Human) | N.A. |
| Experiment for Molecule Alteration |
Western blot assay | |||
| Experiment for Drug Resistance |
MTT assay; Flow cytometric assay; Colonyformation assay | |||
| Mechanism Description | Our results show that calycosin inhibits the proliferation and migration abilities of CL1-0 GEMR cells, and that these effects might be through the LDOC1/GNL3L/NFkappaB pathway. These findings improve our understanding of the anti-tumor activity and potential mechanisms of calycosin in gemcitabine-resistant lung cancer cells, and offer valuable support for the clinical application of calycosin in treating gemcitabine-resistant lung cancer. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
