Molecule Information

General Information of the Molecule (ID: Mol04166)

• Name: Transglutaminase 3 (TGM3) ,Homo sapiens
• Synonyms: Transglutaminase E; Transglutaminase-3
• Molecule Type: Protein
• Gene Name: TGM3
• Gene ID: 7053
• Location: chr20:2296001-2341079[+]
• Sequence:
  MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST
  GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ
  GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ
  FEEDILSICLSILDRSLNFRRDAATDVASRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
  YTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
  HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
  SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG
  RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQE
  PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT
  MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE
  VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKEGSRVRFD
  ILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE
• 3D-structure: PDB ID: 8OXW; Classification: Transferase; Method: X-ray diffraction; Resolution: 1.70 Å
• Function: Catalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath. .
• Uniprot ID: TGM3_HUMAN
• Ensembl ID: ENSG00000125780
• HGNC ID: HGNC:11779

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Metabolic Reprogramming via Altered Pathways (MRAP)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Metabolic Type: Glutamine metabolism
• Resistant Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: Het-1A cells; Esophagus; Homo sapiens (Human); CVCL_3702
• In Vitro Model: KYSE-30 cells; Esophagus; Homo sapiens (Human); CVCL_1351
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: Cell proliferation assay
• Mechanism Description: The results revealed that miR?106b?3p levels were upregulated, whereas TMG3 levels were downregulated in ESCC tissues. Dual?luciferase reporter assays confirmed that miR?106b?3p negatively regulated TGM3 expression by binding to its 3'UTR sequence. It was also shown that inhibition of miR?106b?3p could enhance the anti?proliferative effects, while promoting the apoptotic effects of cisplatin in the KYSE30 cell line by targeting TGM3. In conclusion, the present study demonstrated that downregulation of miR?106b?3p may increase the sensitivity of KYSE30 cell to cisplatin by targeting TGM3.

References

• Ref 1: Downregulation of miR?106b?3p increases sensitivity to cisplatin in esophageal cancer cells by targeting TGM3. Mol Med Rep. 2021 Jun;23(6):471.