Molecule Information

General Information of the Molecule (ID: Mol04158)

Name	Solute carrier family 25 member 17 (SLC25A17) ,Homo sapiens
Synonyms	34 kDa peroxisomal membrane protein; Solute carrier family 25 member 17 Click to Show/Hide
Molecule Type	Protein
Gene ID	10478
Location	chr22:40769630-40819399[-]
Sequence	MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEG LLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTT PLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPA IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPE NRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG LKRAHQH Click to Show/Hide
Function	Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extent for nicotinamide adenine dinucleotide (NAD(+)), adenosine diphosphate (ADP) and adenosine 3',5'-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD(+) from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. . Click to Show/Hide
Uniprot ID	PM34_HUMAN
Ensembl ID	ENSG00000100372
HGNC ID	HGNC:10987
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Enzalutamide

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Metabolic Reprogramming via Altered Pathways (MRAP)			Click to Show/Hide
Disease Class: Prostate cancer [ICD-11: 2C82.0]				[1]
Metabolic Type	Lipid metabolism
Resistant Disease	Prostate cancer [ICD-11: 2C82.0]			Disease Info
Resistant Drug	Enzalutamide			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	C4-2B cells	Prostate	Homo sapiens (Human)	CVCL_4784
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	Cell viability assay
Mechanism Description	Mechanistically, silencing of SLC25A17 and SLC27A6 led to the downregulation of FASN and ACC and their downstream metabolic products including triglycerides and lactic acid with a decrease in cell proliferation and migration in C4-2B enzalutamide resistant cells (Figures 5 and 6). Suppression of SLC25A17 and SLC27A6 delays cell cycle progression with the reduction in the protein expression of CyclinD1 and CDK6 in enzalutamide resistant cells (Figures 4 and 5).

References

Ref 1	Role of solute carrier transporters SLC25A17 and SLC27A6 in acquired resistance to enzalutamide in castration-resistant prostate cancer. Mol Carcinog. 2022 Apr;61(4):397-407.