Molecule Information
General Information of the Molecule (ID: Mol04123)
| Name |
Ladybird homeobox 1 (LBX1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Ladybird homeobox protein homolog 1
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
LBX1
|
||||
| Gene ID | |||||
| Location |
chr10:101226994-101229463[-]
|
||||
| Sequence |
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLL
AAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL KRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPG APKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD Click to Show/Hide
|
||||
| Function |
Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord. .
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Prostate cancer [ICD-11: 2C82.0] | [1] | |||
| Metabolic Type | Glutamine metabolism | |||
| Resistant Disease | Prostate cancer [ICD-11: 2C82.0] | |||
| Resistant Drug | Enzalutamide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | LNCaP cells | Prostate | Homo sapiens (Human) | CVCL_0395 |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
Cell viability assay | |||
| Mechanism Description | We compared the transcriptomic profile of paired enzalutamide-sensitive and resistant LNCaP and C4-10B prostate cancer cells for identification of genes involved in drug resistance by performing an unbiased bioinformatics analysis and further validation | |||
| Disease Class: Prostate cancer [ICD-11: 2C82.0] | [1] | |||
| Metabolic Type | Glutamine metabolism | |||
| Resistant Disease | Prostate cancer [ICD-11: 2C82.0] | |||
| Resistant Drug | Enzalutamide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | C4-2B cells | Prostate | Homo sapiens (Human) | CVCL_4784 |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
Cell viability assay | |||
| Mechanism Description | We compared the transcriptomic profile of paired enzalutamide-sensitive and resistant LNCaP and C4-19B prostate cancer cells for identification of genes involved in drug resistance by performing an unbiased bioinformatics analysis and further validation | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
