Molecule Information

General Information of the Molecule (ID: Mol04117)

• Name: Homeobox D10 (HOXD10) ,Homo sapiens
• Synonyms: Homeobox protein Hox-4D; Homeobox protein Hox-4E
• Molecule Type: Protein
• Gene Name: HOXD10
• Gene ID: 3236
• Location: chr2:176108790-176119937[+]
• Sequence:
  MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKR
  EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKR
  NKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQL
  NPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSP
  EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
  KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
• Function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Uniprot ID: HXD10_HUMAN
• Ensembl ID: ENSG00000128710
• HGNC ID: HGNC:5133

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Enzalutamide

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Metabolic Reprogramming via Altered Pathways (MRAP)

Disease Class: Prostate cancer [ICD-11: 2C82.0] [1]

• Metabolic Type: Glutamine metabolism
• Resistant Disease: Prostate cancer [ICD-11: 2C82.0]
• Resistant Drug: Enzalutamide
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: C4-2B cells; Prostate; Homo sapiens (Human); CVCL_4784
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: Cell viability assay
• Mechanism Description: We compared the transcriptomic profile of paired enzalutamide-sensitive and resistant LNCaP and C4-13B prostate cancer cells for identification of genes involved in drug resistance by performing an unbiased bioinformatics analysis and further validation

Disease Class: Prostate cancer [ICD-11: 2C82.0] [1]

• Metabolic Type: Glutamine metabolism
• Resistant Disease: Prostate cancer [ICD-11: 2C82.0]
• Resistant Drug: Enzalutamide
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: LNCaP cells; Prostate; Homo sapiens (Human); CVCL_0395
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: Cell viability assay
• Mechanism Description: We compared the transcriptomic profile of paired enzalutamide-sensitive and resistant LNCaP and C4-4B prostate cancer cells for identification of genes involved in drug resistance by performing an unbiased bioinformatics analysis and further validation

References

• Ref 1: Metabolic Reprogramming and Predominance of Solute Carrier Genes during Acquired Enzalutamide Resistance in Prostate Cancer. Cells. 2020 Nov 24;9(12):2535.