Molecule Information

General Information of the Molecule (ID: Mol04102)
Name
Cytidine triphosphate synthase 1 (CTPS1) ,Homo sapiens
Synonyms
CTP synthetase 1; UTP--ammonia ligase 1
    Click to Show/Hide
Molecule Type
Protein
Gene Name
CTPS1
Gene ID
1503
Location
chr1:40979300-41012565[+]
Sequence
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFV
LDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDA
IQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHV
SLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQ
VICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
IALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQK
LCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN
STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRH
RFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPY
FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
    Click to Show/Hide
3D-structure
PDB ID
7MGZ
Classification
Ligase
Method
Electron microscopy
Resolution
2.80  Å
Function
This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity. .
    Click to Show/Hide
Uniprot ID
PYRG1_HUMAN
Ensembl ID
ENSG00000171793
HGNC ID
HGNC:2519
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  MRAP: Metabolic Reprogramming via Altered Pathways
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Bortezomib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Metabolic Reprogramming via Altered Pathways (MRAP) Click to Show/Hide
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Bortezomib
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model 293 T cells Blood Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS10 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Bortezomib
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model NCI-H929 cells Bone marrow Homo sapiens (Human) CVCL_1600
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS6 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Bortezomib
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model MM1 S cells Blood Homo sapiens (Human) CVCL_8792
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS7 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Bortezomib
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model U266B1 cells Blood Homo sapiens (Human) CVCL_0566
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS8 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Bortezomib
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model RPMI 8226 cells Peripheral blood Homo sapiens (Human) CVCL_7353
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS9 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Selinexor
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Metabolic Reprogramming via Altered Pathways (MRAP) Click to Show/Hide
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Selinexor
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model NCI-H929 cells Bone marrow Homo sapiens (Human) CVCL_1600
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS1 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Selinexor
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model MM1 S cells Blood Homo sapiens (Human) CVCL_8792
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS2 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Selinexor
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model U266B1 cells Blood Homo sapiens (Human) CVCL_0566
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS3 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Selinexor
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model RPMI 8226 cells Peripheral blood Homo sapiens (Human) CVCL_7353
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS4 is mainly involved in cytidine metabolism and nucleic acids metabolism.
Disease Class: Multiple myeloma [ICD-11: 2A83.0] [1]
Metabolic Type Nucleic acid metabolism
Resistant Disease Multiple myeloma [ICD-11: 2A83.0]
 Disease Info 
Resistant Drug Selinexor
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model 293 T cells Blood Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration		 qRT-PCR; Western blot analysis
Experiment for
Drug Resistance		 Cell viability assay
Mechanism Description Among these, upregulation of CTPS1 was associated with poor prognosis in MM and drug resistance recurrence. CTPS5 is mainly involved in cytidine metabolism and nucleic acids metabolism.
References
Ref 1 Cytidine triphosphate synthase 1-mediated metabolic reprogramming promotes proliferation and drug resistance in multiple myeloma. Heliyon. 2024 Jun 20;10(13):e33001.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.