Molecule Information

General Information of the Molecule (ID: Mol04032)

Name	Glucose-6-phosphatase catalytic subunit (G6PC) ,Homo sapiens
Synonyms	Glucose-6-phosphatase; Glucose-6-phosphatase alpha Click to Show/Hide
Molecule Type	Protein
Gene Name	G6PC1
Gene ID	2538
Location	chr17:42900797-42914438[+]
Sequence	MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL Click to Show/Hide
Function	Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. Forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production in the terminal step of glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels. . Click to Show/Hide
Uniprot ID	G6PC1_HUMAN
Ensembl ID	ENSG00000131482
HGNC ID	HGNC:4056
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Sorafenib

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Metabolic Reprogramming via Altered Pathways (MRAP)		Click to Show/Hide
Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02]			[1]
Metabolic Type	Lipid metabolism
Resistant Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]		Disease Info
Resistant Drug	Sorafenib		Drug Info
Molecule Alteration	Expression	Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Experiment for Molecule Alteration	qRT-PCR; Western blot analysis
Experiment for Drug Resistance	Spheroids formation assay
Mechanism Description	Here, we confirmed the synergic effect of antimiR-494/sorafenib treatment and demonstrated for the first time that, together with AKT pathway repression, G6pc targeting mediates miR-494-induced sorafenib resistance in HCC cells. In line, the oncomiR-21 triggered sorafenib resistance in HCC cells by PTEN direct targeting or by regulating the nuclear localization of the long non-coding RNA SNHG1 [63].

References

Ref 1	MiR-494 induces metabolic changes through G6pc targeting and modulates sorafenib response in hepatocellular carcinoma. J Exp Clin Cancer Res. 2023 Jun 10;42(1):145.