Molecule Information

General Information of the Molecule (ID: Mol04012)

• Name: Adrenomedullin (ADM) ,Homo sapiens
• Molecule Type: Protein
• Gene Name: ADM5
• Gene ID: 199800
• Location: chr19:49689594-49690575[+]
• Sequence:
  MTIHILILLLLLAFSAQGDLDTAARRGQHQVPQHRGHVCYLGVCRTHRLAEIIYWIRCLH
  QGALGEGQPRAPGPLQLWAPPVARGGSPARFPGFRPAARGLAQCPARWVTSGTARPLLGF
  SLPICMLELLLHISSPLTPAPETVFPSPSPGCD
• Function: Probable non-functional remnant of adrenomedullin-5. .
• Uniprot ID: ADM5_HUMAN
• Ensembl ID: ENSG00000224420
• HGNC ID: HGNC:27293

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Metabolic Reprogramming via Altered Pathways (MRAP)

Disease Class: Ovarian cancer [ICD-11: 2C73.0] [1]

• Metabolic Type: Glucose metabolism
• Resistant Disease: Ovarian cancer [ICD-11: 2C73.0]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation

Differential expression of the molecule in resistant disease

• Classification of Disease: Ovarian cancer [ICD-11: 2C73]
• The Specified Disease: Ovarian cancer
• The Studied Tissue: Blood
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.98E-25; Fold-change: 3.57E-01; Z-score: 1.20E+01
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: A2780CIS cells; Ovary; Homo sapiens (Human); CVCL_1942
• Experiment for Molecule Alteration: RNA seq
• Experiment for Drug Resistance: CCK8 assay
• Mechanism Description: The present study demonstrated that ADM can induce cisplatin chemoresistance in human ovarian epithelial carcinoma cells through reprogramming of glucose metabolism via upregulation of PKM2 and subsequently contribute to cancer prevention and therapy. This conclusion is supported by the following observations: (1)ADMexpression was upregulated in cisplatin-resistant EOC cells; (2) ADM attenuated cisplatin-inhibited cell survival and cisplatin-induced apoptosis in sensitive EOC cells; (3) knockdown of ADM enhanced cisplatin chemosensitivity of cisplatin-resistant EOC cells; (4) ADM enhanced glycolysis in cisplatin-sensitive EOC cells; (5) knockdown of ADM significantly inhibited glycolysis in cisplatin-resistant EOC cells; and (6) ADM significantly upregulated PKM2 protein level, the key enzyme during glycolysis.

Disease Class: Ovarian cancer [ICD-11: 2C73.0] [1]

• Metabolic Type: Glucose metabolism
• Resistant Disease: Ovarian cancer [ICD-11: 2C73.0]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation

Differential expression of the molecule in resistant disease

• Classification of Disease: Ovarian cancer [ICD-11: 2C73]
• The Specified Disease: Ovarian cancer
• The Studied Tissue: Blood
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.98E-25; Fold-change: 3.57E-01; Z-score: 1.20E+01
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: A2780 EOC cells; Ovary; Homo sapiens (Human); CVCL_0134
• Experiment for Molecule Alteration: RNA seq
• Experiment for Drug Resistance: CCK8 assay
• Mechanism Description: The present study demonstrated that ADM can induce cisplatin chemoresistance in human ovarian epithelial carcinoma cells through reprogramming of glucose metabolism via upregulation of PKM2 and subsequently contribute to cancer prevention and therapy. This conclusion is supported by the following observations: (1) ADM expression was upregulated in cisplatin-resistant EOC cells; (2) ADM attenuated cisplatin-inhibited cell survival and cisplatin-induced apoptosis in sensitive EOC cells; (3) knockdown of ADM enhanced cisplatin chemosensitivity of cisplatin-resistant EOC cells; (4) ADM enhanced glycolysis in cisplatin-sensitive EOC cells; (5) knockdown of ADM significantly inhibited glycolysis in cisplatin-resistant EOC cells; and (6) ADM significantly upregulated PKM2 protein level, the key enzyme during glycolysis.

References

• Ref 1: Adrenomedullin induces cisplatin chemoresistance in ovarian cancer through reprogramming of glucose metabolism. J Transl Int Med. 2023 Jul 5;11(2):169-177.