Molecule Information
General Information of the Molecule (ID: Mol04008)
| Name |
Histone cluster 1 H1 family member d (HIST1H1D)
,Macaca mulatta
|
||||
|---|---|---|---|---|---|
| Molecule Type |
Protein
|
||||
| Gene ID | |||||
| Sequence |
MSETAPVAPITPAPAEKIPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSL
AALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPK AKKAGSAKPRKPAAAAKKPKKASGAATPKKSVKKTSKKAKKPATAAGTKKVAKSAKKVKT PQPKKAAKSPAKAKAPKPKAAKPKSAKPKVTKAKKAAPKKK Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Prostate cancer [ICD-11: 2C82.0] | [1] | |||
| Metabolic Type | Glutamine metabolism | |||
| Resistant Disease | Prostate cancer [ICD-11: 2C82.0] | |||
| Resistant Drug | Enzalutamide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | C4-2B cells | Prostate | Homo sapiens (Human) | CVCL_4784 |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
Cell viability assay | |||
| Mechanism Description | We compared the transcriptomic profile of paired enzalutamide-sensitive and resistant LNCaP and C4-12B prostate cancer cells for identification of genes involved in drug resistance by performing an unbiased bioinformatics analysis and further validation | |||
| Disease Class: Prostate cancer [ICD-11: 2C82.0] | [1] | |||
| Metabolic Type | Glutamine metabolism | |||
| Resistant Disease | Prostate cancer [ICD-11: 2C82.0] | |||
| Resistant Drug | Enzalutamide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | LNCaP cells | Prostate | Homo sapiens (Human) | CVCL_0395 |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
Cell viability assay | |||
| Mechanism Description | We compared the transcriptomic profile of paired enzalutamide-sensitive and resistant LNCaP and C4-3B prostate cancer cells for identification of genes involved in drug resistance by performing an unbiased bioinformatics analysis and further validation | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
