Molecule Information
General Information of the Molecule (ID: Mol02131)
Name |
WT1 associated protein (WTAP)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
KIAA0105; MGC3925; Mum29589
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
WTAP
|
||||
Gene ID | |||||
Location |
chr6:159,725,585-159,756,319 forward strand.
|
||||
Sequence |
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE
KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ QQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSH DPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL Click to Show/Hide
|
||||
Function |
Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Natural killer/T-cell lymphoma | [1] | |||
Sensitive Disease | Natural killer/T-cell lymphoma [ICD-11: 2A90.2] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | YTS cells | Pleural effusion | Homo sapiens (Human) | CVCL_D324 |
SNK-6 cells | Oral | Homo sapiens (Human) | CVCL_A673 | |
Experiment for Molecule Alteration |
qRT-PCR; Western blotting assay | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | WTAP enhanced dual-specificity phosphatases 6 (DUSP6) expression by increasing m6A levels of DUSP6 mRNA transcript, leading to oncogenic functions in NKTCL. WTAP contributed to the progression and chemotherapy sensitivity of NKTCL by stabilizing DUSP6 mRNA in an m6A-dependent manner. Taken together, these findings uncovered a critical function for WTAP-guided m6A methylation and identified DUSP6 as an important target of m6A modification in the regulation of chemotherapy resistance in NKTCL oncogenesis. Deletion of WTAP impaired chemotherapy resistance to DDP in human NKTCL cells. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.