Molecule Information
      General Information of the Molecule (ID: Mol02109)
  
  | Name | (Na+)-NQR maturation NqrM (nqrM)
                                ,Vibrio alginolyticus
                               | ||||
|---|---|---|---|---|---|
| Synonyms | (Na+)-NQR maturation NqrM; nqrM; AOG25_00280; F0254_11835; HKB35_09295; HUO05_09255     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | nqrM | ||||
| Gene ID | |||||
| Sequence | MNTFLITFAVFVAVITAMAVGYIFQKKVVKGSCGGLGAVGIEKVCNCPEPCDARKKREAR EAARAEKLAAWEKDRIA     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Vibrio alginolyticus infection | [1] | |||
| Resistant Disease | Vibrio alginolyticus infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Balofloxacin | |||
| Molecule Alteration | Expression | Down-regulation | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| Experiment for Molecule Alteration | Western blotting analysis | |||
| Mechanism Description | Na(+)-NQR is a membrane-embedded NADH dehydrogenase. Down-regulation of the Na(+)-NQR is required for V. alginolyticus in resistance to BLFX. It is known that the resistant mechanisms of a quinolone antibiotic are through the inhibition of DNA-gyrase which is required for DNA synthesis, and expressional changes of OM proteins which elevate pump activity and decrease OM permeability. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
