Molecule Information
General Information of the Molecule (ID: Mol02109)
| Name |
(Na+)-NQR maturation NqrM (nqrM)
,Vibrio alginolyticus
|
||||
|---|---|---|---|---|---|
| Synonyms |
(Na+)-NQR maturation NqrM; nqrM; AOG25_00280; F0254_11835; HKB35_09295; HUO05_09255
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
nqrM
|
||||
| Gene ID | |||||
| Sequence |
MNTFLITFAVFVAVITAMAVGYIFQKKVVKGSCGGLGAVGIEKVCNCPEPCDARKKREAR
EAARAEKLAAWEKDRIA Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio alginolyticus infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Vibrio alginolyticus infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Balofloxacin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Mechanism Description | Na(+)-NQR is a membrane-embedded NADH dehydrogenase. Down-regulation of the Na(+)-NQR is required for V. alginolyticus in resistance to BLFX. It is known that the resistant mechanisms of a quinolone antibiotic are through the inhibition of DNA-gyrase which is required for DNA synthesis, and expressional changes of OM proteins which elevate pump activity and decrease OM permeability. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
