General Information of the Molecule (ID: Mol02109)
Name
(Na+)-NQR maturation NqrM (nqrM) ,Vibrio alginolyticus
Synonyms
(Na+)-NQR maturation NqrM; nqrM; AOG25_00280; F0254_11835; HKB35_09295; HUO05_09255
    Click to Show/Hide
Molecule Type
Protein
Gene Name
nqrM
Gene ID
61533190
Sequence
MNTFLITFAVFVAVITAMAVGYIFQKKVVKGSCGGLGAVGIEKVCNCPEPCDARKKREAR
EAARAEKLAAWEKDRIA
    Click to Show/Hide
Uniprot ID
A0A0H0YCL5_VIBAL
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Vibrionales
Family: Vibrionaceae
Genus: Vibrio
Species: Vibrio alginolyticus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Balofloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Vibrio alginolyticus infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Vibrio alginolyticus infection [ICD-11: 1A00-1C4Z]
Resistant Drug Balofloxacin
Molecule Alteration Expression
Down-regulation
Experimental Note Discovered Using In-vivo Testing Model
Experiment for
Molecule Alteration
Western blot analysis
Mechanism Description Na(+)-NQR is a membrane-embedded NADH dehydrogenase. Down-regulation of the Na(+)-NQR is required for V. alginolyticus in resistance to BLFX. It is known that the resistant mechanisms of a quinolone antibiotic are through the inhibition of DNA-gyrase which is required for DNA synthesis, and expressional changes of OM proteins which elevate pump activity and decrease OM permeability.
References
Ref 1 Downregulation of Na(+)-NQR complex is essential for Vibrio alginolyticus in resistance to balofloxacin .J Proteomics. 2012 May 17;75(9):2638-48. doi: 10.1016/j.jprot.2012.03.006. Epub 2012 Mar 17. 10.1016/j.jprot.2012.03.006

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.